prot_P-lacustris_contig1006.155.1 (polypeptide) Pleurocladia lacustris SAG_25_93
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: A0A256BF49_9CYAN (Uncharacterized protein n=1 Tax=Pseudanabaena sp. SR411 TaxID=1980935 RepID=A0A256BF49_9CYAN) HSP 1 Score: 60.5 bits (145), Expect = 3.870e-8 Identity = 28/43 (65.12%), Postives = 33/43 (76.74%), Query Frame = 0 Query: 3 IFEKSLGRDHPNVATILNNRAELLREQGKYAEADPLYLRAIEI 45 I E+ LG DHP+VA LNN A L QGKY+EA+PLYLRAI+I Sbjct: 6 ILERQLGADHPSVAASLNNLALLYEAQGKYSEAEPLYLRAIQI 48
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: B0JTC7_MICAN (Kinesin light chain 1 n=1 Tax=Microcystis aeruginosa (strain NIES-843 / IAM M-2473) TaxID=449447 RepID=B0JTC7_MICAN) HSP 1 Score: 59.3 bits (142), Expect = 3.940e-7 Identity = 27/38 (71.05%), Postives = 32/38 (84.21%), Query Frame = 0 Query: 8 LGRDHPNVATILNNRAELLREQGKYAEADPLYLRAIEI 45 LG +HP+VAT LNN A+L R QGKYAEA+PLYLRA+ I Sbjct: 5 LGEEHPDVATSLNNLADLYRAQGKYAEAEPLYLRALAI 42
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: A0A256BD07_9CYAN (Uncharacterized protein n=2 Tax=Pseudanabaena sp. SR411 TaxID=1980935 RepID=A0A256BD07_9CYAN) HSP 1 Score: 56.6 bits (135), Expect = 9.040e-7 Identity = 25/39 (64.10%), Postives = 30/39 (76.92%), Query Frame = 0 Query: 3 IFEKSLGRDHPNVATILNNRAELLREQGKYAEADPLYLR 41 I E+ LG +HPN A LNN AEL + QGKY+EA+PLYLR Sbjct: 6 ILERQLGANHPNFAFSLNNLAELYKSQGKYSEAEPLYLR 44
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: UPI001CFC99EF (tetratricopeptide repeat protein n=1 Tax=Microseira wollei TaxID=467598 RepID=UPI001CFC99EF) HSP 1 Score: 57.0 bits (136), Expect = 1.550e-6 Identity = 25/41 (60.98%), Postives = 32/41 (78.05%), Query Frame = 0 Query: 2 EIFEKSLGRDHPNVATILNNRAELLREQGKYAEADPLYLRA 42 E+ ++ LG DHPNVAT LNN A L QG+Y+EA+PLYL+A Sbjct: 3 ELIKRLLGEDHPNVATSLNNLAGLYDSQGRYSEAEPLYLQA 43
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: A0A7S3NNH9_9STRA (Hypothetical protein n=2 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3NNH9_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 4.140e-6 Identity = 29/44 (65.91%), Postives = 33/44 (75.00%), Query Frame = 0 Query: 2 EIFEKSLGRDHPNVATILNNRAELLREQGKYAEADPLYLRAIEI 45 EI EK+LG +HP++AT LNN A LL QGKY EA LY RAIEI Sbjct: 1 EIGEKTLGPNHPDLATRLNNLAGLLENQGKYDEAKLLYERAIEI 44
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: A0A7S3K3F8_9STRA (Hypothetical protein n=1 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3K3F8_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 4.140e-6 Identity = 29/44 (65.91%), Postives = 33/44 (75.00%), Query Frame = 0 Query: 2 EIFEKSLGRDHPNVATILNNRAELLREQGKYAEADPLYLRAIEI 45 EI EK+LG +HP++AT LNN A LL QGKY EA LY RAIEI Sbjct: 1 EIGEKTLGPNHPDLATRLNNLAGLLENQGKYDEAKLLYERAIEI 44
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: UPI001BE10FAB (tetratricopeptide repeat protein n=1 Tax=Klebsiella pneumoniae TaxID=573 RepID=UPI001BE10FAB) HSP 1 Score: 54.3 bits (129), Expect = 4.450e-6 Identity = 24/39 (61.54%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 7 SLGRDHPNVATILNNRAELLREQGKYAEADPLYLRAIEI 45 +LG DHP+VAT LNN AEL R QG+YA+A+PL+ R++ I Sbjct: 1 ALGPDHPDVATSLNNLAELYRSQGQYAQAEPLFKRSLAI 39
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: A0A1F2STV2_9BACT (Uncharacterized protein n=1 Tax=Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13 TaxID=1797178 RepID=A0A1F2STV2_9BACT) HSP 1 Score: 55.1 bits (131), Expect = 4.510e-6 Identity = 25/41 (60.98%), Postives = 31/41 (75.61%), Query Frame = 0 Query: 3 IFEKSLGRDHPNVATILNNRAELLREQGKYAEADPLYLRAI 43 I+EK+LG +HPNV LNN A L QGKYA+A+PLY RA+ Sbjct: 3 IWEKALGPEHPNVGQSLNNLAGLYAAQGKYADAEPLYKRAL 43
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: A0A3M2GEV5_9CYAN (Tetratricopeptide repeat protein (Fragment) n=1 Tax=Cyanobacteria bacterium J007 TaxID=2420339 RepID=A0A3M2GEV5_9CYAN) HSP 1 Score: 57.0 bits (136), Expect = 4.920e-6 Identity = 24/44 (54.55%), Postives = 33/44 (75.00%), Query Frame = 0 Query: 2 EIFEKSLGRDHPNVATILNNRAELLREQGKYAEADPLYLRAIEI 45 ++ ++ G++HPNVAT LNN A L QG+YAEA+PLYL A+ I Sbjct: 113 QLAQEQWGKEHPNVATSLNNLAGLYESQGRYAEAEPLYLEAVRI 156
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: A0A7S3NQ03_9STRA (Hypothetical protein n=2 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3NQ03_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 1.170e-5 Identity = 29/44 (65.91%), Postives = 33/44 (75.00%), Query Frame = 0 Query: 2 EIFEKSLGRDHPNVATILNNRAELLREQGKYAEADPLYLRAIEI 45 EI EK+LG +HP++AT LNN A LL QGKY EA LY RAIEI Sbjct: 1 EIGEKTLGPNHPDLATRLNNLAGLLENQGKYDEAKLLYERAIEI 44 The following BLAST results are available for this feature:
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 16 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-lacustris_contig1006.155.1 ID=prot_P-lacustris_contig1006.155.1|Name=mRNA_P-lacustris_contig1006.155.1|organism=Pleurocladia lacustris SAG_25_93|type=polypeptide|length=450bpback to top |