mRNA_P-lacustris_contig1006.155.1 (mRNA) Pleurocladia lacustris SAG_25_93
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: A0A256BF49_9CYAN (Uncharacterized protein n=1 Tax=Pseudanabaena sp. SR411 TaxID=1980935 RepID=A0A256BF49_9CYAN) HSP 1 Score: 60.5 bits (145), Expect = 3.870e-8 Identity = 28/43 (65.12%), Postives = 33/43 (76.74%), Query Frame = 1 Query: 7 IFEKSLGRDHPNVATILNNRAELLREQGKYAEADPLYLRAIEI 135 I E+ LG DHP+VA LNN A L QGKY+EA+PLYLRAI+I Sbjct: 6 ILERQLGADHPSVAASLNNLALLYEAQGKYSEAEPLYLRAIQI 48
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: B0JTC7_MICAN (Kinesin light chain 1 n=1 Tax=Microcystis aeruginosa (strain NIES-843 / IAM M-2473) TaxID=449447 RepID=B0JTC7_MICAN) HSP 1 Score: 59.3 bits (142), Expect = 3.940e-7 Identity = 27/38 (71.05%), Postives = 32/38 (84.21%), Query Frame = 1 Query: 22 LGRDHPNVATILNNRAELLREQGKYAEADPLYLRAIEI 135 LG +HP+VAT LNN A+L R QGKYAEA+PLYLRA+ I Sbjct: 5 LGEEHPDVATSLNNLADLYRAQGKYAEAEPLYLRALAI 42
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: A0A256BD07_9CYAN (Uncharacterized protein n=2 Tax=Pseudanabaena sp. SR411 TaxID=1980935 RepID=A0A256BD07_9CYAN) HSP 1 Score: 56.6 bits (135), Expect = 9.040e-7 Identity = 25/39 (64.10%), Postives = 30/39 (76.92%), Query Frame = 1 Query: 7 IFEKSLGRDHPNVATILNNRAELLREQGKYAEADPLYLR 123 I E+ LG +HPN A LNN AEL + QGKY+EA+PLYLR Sbjct: 6 ILERQLGANHPNFAFSLNNLAELYKSQGKYSEAEPLYLR 44
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: UPI001CFC99EF (tetratricopeptide repeat protein n=1 Tax=Microseira wollei TaxID=467598 RepID=UPI001CFC99EF) HSP 1 Score: 57.0 bits (136), Expect = 1.550e-6 Identity = 25/41 (60.98%), Postives = 32/41 (78.05%), Query Frame = 1 Query: 4 EIFEKSLGRDHPNVATILNNRAELLREQGKYAEADPLYLRA 126 E+ ++ LG DHPNVAT LNN A L QG+Y+EA+PLYL+A Sbjct: 3 ELIKRLLGEDHPNVATSLNNLAGLYDSQGRYSEAEPLYLQA 43
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: A0A7S3NNH9_9STRA (Hypothetical protein n=2 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3NNH9_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 4.140e-6 Identity = 29/44 (65.91%), Postives = 33/44 (75.00%), Query Frame = 1 Query: 4 EIFEKSLGRDHPNVATILNNRAELLREQGKYAEADPLYLRAIEI 135 EI EK+LG +HP++AT LNN A LL QGKY EA LY RAIEI Sbjct: 1 EIGEKTLGPNHPDLATRLNNLAGLLENQGKYDEAKLLYERAIEI 44
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: A0A7S3K3F8_9STRA (Hypothetical protein n=1 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3K3F8_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 4.140e-6 Identity = 29/44 (65.91%), Postives = 33/44 (75.00%), Query Frame = 1 Query: 4 EIFEKSLGRDHPNVATILNNRAELLREQGKYAEADPLYLRAIEI 135 EI EK+LG +HP++AT LNN A LL QGKY EA LY RAIEI Sbjct: 1 EIGEKTLGPNHPDLATRLNNLAGLLENQGKYDEAKLLYERAIEI 44
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: UPI001BE10FAB (tetratricopeptide repeat protein n=1 Tax=Klebsiella pneumoniae TaxID=573 RepID=UPI001BE10FAB) HSP 1 Score: 54.3 bits (129), Expect = 4.450e-6 Identity = 24/39 (61.54%), Postives = 32/39 (82.05%), Query Frame = 1 Query: 19 SLGRDHPNVATILNNRAELLREQGKYAEADPLYLRAIEI 135 +LG DHP+VAT LNN AEL R QG+YA+A+PL+ R++ I Sbjct: 1 ALGPDHPDVATSLNNLAELYRSQGQYAQAEPLFKRSLAI 39
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: A0A1F2STV2_9BACT (Uncharacterized protein n=1 Tax=Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13 TaxID=1797178 RepID=A0A1F2STV2_9BACT) HSP 1 Score: 55.1 bits (131), Expect = 4.510e-6 Identity = 25/41 (60.98%), Postives = 31/41 (75.61%), Query Frame = 1 Query: 7 IFEKSLGRDHPNVATILNNRAELLREQGKYAEADPLYLRAI 129 I+EK+LG +HPNV LNN A L QGKYA+A+PLY RA+ Sbjct: 3 IWEKALGPEHPNVGQSLNNLAGLYAAQGKYADAEPLYKRAL 43
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: A0A3M2GEV5_9CYAN (Tetratricopeptide repeat protein (Fragment) n=1 Tax=Cyanobacteria bacterium J007 TaxID=2420339 RepID=A0A3M2GEV5_9CYAN) HSP 1 Score: 57.0 bits (136), Expect = 4.920e-6 Identity = 24/44 (54.55%), Postives = 33/44 (75.00%), Query Frame = 1 Query: 4 EIFEKSLGRDHPNVATILNNRAELLREQGKYAEADPLYLRAIEI 135 ++ ++ G++HPNVAT LNN A L QG+YAEA+PLYL A+ I Sbjct: 113 QLAQEQWGKEHPNVATSLNNLAGLYESQGRYAEAEPLYLEAVRI 156
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Match: A0A7S3NQ03_9STRA (Hypothetical protein n=2 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3NQ03_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 1.170e-5 Identity = 29/44 (65.91%), Postives = 33/44 (75.00%), Query Frame = 1 Query: 4 EIFEKSLGRDHPNVATILNNRAELLREQGKYAEADPLYLRAIEI 135 EI EK+LG +HP++AT LNN A LL QGKY EA LY RAIEI Sbjct: 1 EIGEKTLGPNHPDLATRLNNLAGLLENQGKYDEAKLLYERAIEI 44 The following BLAST results are available for this feature:
BLAST of mRNA_P-lacustris_contig1006.155.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 16 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-lacustris_contig1006.155.1 >prot_P-lacustris_contig1006.155.1 ID=prot_P-lacustris_contig1006.155.1|Name=mRNA_P-lacustris_contig1006.155.1|organism=Pleurocladia lacustris SAG_25_93|type=polypeptide|length=450bp QEIFEKSLGRDHPNVATILNNRAELLREQGKYAEADPLYLRAIEIGEKTLback to top mRNA from alignment at P-lacustris_contig1006:5741..40714- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-lacustris_contig1006.155.1 ID=mRNA_P-lacustris_contig1006.155.1|Name=mRNA_P-lacustris_contig1006.155.1|organism=Pleurocladia lacustris SAG_25_93|type=mRNA|length=34974bp|location=Sequence derived from alignment at P-lacustris_contig1006:5741..40714- (Pleurocladia lacustris SAG_25_93)back to top Coding sequence (CDS) from alignment at P-lacustris_contig1006:5741..40714- >mRNA_P-lacustris_contig1006.155.1 ID=mRNA_P-lacustris_contig1006.155.1|Name=mRNA_P-lacustris_contig1006.155.1|organism=Pleurocladia lacustris SAG_25_93|type=CDS|length=2700bp|location=Sequence derived from alignment at P-lacustris_contig1006:5741..40714- (Pleurocladia lacustris SAG_25_93)back to top |