mRNA_P-lacustris_contig101.179.1 (mRNA) Pleurocladia lacustris SAG_25_93
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_P-lacustris_contig101.179.1 vs. uniprot
Match: A0A6C0JA70_9ZZZZ (DUF4338 domain-containing protein n=1 Tax=viral metagenome TaxID=1070528 RepID=A0A6C0JA70_9ZZZZ) HSP 1 Score: 67.8 bits (164), Expect = 2.210e-9 Identity = 30/81 (37.04%), Postives = 56/81 (69.14%), Query Frame = 2 Query: 479 FKEQAKRRSIQVSINFDEYSSIVRTACWYCGQYTYRGYSGVDRMQNAGTYQKDNVVACCRTCNFMKGSLSVTEFLGKVKDI 721 +K+ + +R+I+ +I+ EY +I+ C YCG + +G +G+DR+ + Y+ N+V CC+TCN +KG+L++ +F K+K+I Sbjct: 365 YKKSSAKRNIKFNISETEYINILTYPCKYCGCFN-QGANGIDRVHSELPYEIGNIVPCCKTCNSLKGTLTLLQFKQKLKNI 444
BLAST of mRNA_P-lacustris_contig101.179.1 vs. uniprot
Match: A0A6C0B6K3_9ZZZZ (Uncharacterized protein n=1 Tax=viral metagenome TaxID=1070528 RepID=A0A6C0B6K3_9ZZZZ) HSP 1 Score: 66.2 bits (160), Expect = 6.170e-9 Identity = 25/70 (35.71%), Postives = 44/70 (62.86%), Query Frame = 2 Query: 512 VSINFDEYSSIVRTACWYCGQYTYRGYSGVDRMQNAGTYQKDNVVACCRTCNFMKGSLSVTEFLGKVKDI 721 + + +++ SI + C+YCG +G++G+DRM + Y+ DN V+CC CN MKG++ F+ +V+ I Sbjct: 254 IDLTIEQFESITKQPCYYCGIIQDKGFNGIDRMDSTKGYEIDNCVSCCTECNMMKGAVDNITFIQRVEHI 323
BLAST of mRNA_P-lacustris_contig101.179.1 vs. uniprot
Match: A0A6C0LRQ9_9ZZZZ (Uncharacterized protein n=1 Tax=viral metagenome TaxID=1070528 RepID=A0A6C0LRQ9_9ZZZZ) HSP 1 Score: 65.5 bits (158), Expect = 1.140e-8 Identity = 30/94 (31.91%), Postives = 51/94 (54.26%), Query Frame = 2 Query: 440 EARKTDVVYRWRVFKEQAKRRSIQVSINFDEYSSIVRTACWYCGQYTYRGYSGVDRMQNAGTYQKDNVVACCRTCNFMKGSLSVTEFLGKVKDI 721 E +T++ ++ + + R + I +DE+ +IV YCG G+DR ++ Y DN +ACC+ CN+MKGSLS+ F+ + + I Sbjct: 217 ELARTNIYEKYNRYIKSCNERCLDFRITYDEFINIVXXXXXYCGYXXXXXXXGIDRKNSSIGYILDNCIACCKMCNYMKGSLSIDVFIKRAEHI 310
BLAST of mRNA_P-lacustris_contig101.179.1 vs. uniprot
Match: L8GNC2_ACACA (Uncharacterized protein n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8GNC2_ACACA) HSP 1 Score: 57.4 bits (137), Expect = 2.900e-7 Identity = 25/81 (30.86%), Postives = 46/81 (56.79%), Query Frame = 2 Query: 479 FKEQAKRRSIQVSINFDEYSSIVRTACWYCGQYTYRGYSGVDRMQNAGTYQKDNVVACCRTCNFMKGSLSVTEFLGKVKDI 721 + ++A +R++ + + ++ + C+ CG R GVDR N Y +N + CC+TCNF+KG+L + + L +V +I Sbjct: 19 YMKKAAKRNLVFELERSHFDELLGSPCYLCGV---RSAGGVDRTDNTVGYTVENAMPCCKTCNFLKGTLPLCDVLTRVDEI 96
BLAST of mRNA_P-lacustris_contig101.179.1 vs. uniprot
Match: A0A6C0ITL0_9ZZZZ (Uncharacterized protein (Fragment) n=1 Tax=viral metagenome TaxID=1070528 RepID=A0A6C0ITL0_9ZZZZ) HSP 1 Score: 59.7 bits (143), Expect = 1.050e-6 Identity = 33/81 (40.74%), Postives = 47/81 (58.02%), Query Frame = 2 Query: 494 KRRSIQVSINFD----EYSSIVRTACWYCGQYTYRGY-SGVDRMQNAGTYQKDNVVACCRTCNFMKGSLSVTEFLGKVKDI 721 +R +IQ INFD E ++ +C+YC G+ +G+DR + Y KDNVV CC+ CN++KGSL +FL V I Sbjct: 279 ERCAIQKGINFDLSKDECCNLFDKSCYYCKHKDDNGFLNGIDRKSSYLGYIKDNVVTCCKMCNYIKGSLGHNDFLQIVDHI 359
BLAST of mRNA_P-lacustris_contig101.179.1 vs. uniprot
Match: A0A6H5JE23_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JE23_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 4.450e-6 Identity = 26/31 (83.87%), Postives = 28/31 (90.32%), Query Frame = -2 Query: 628 MSLTFPKNSVTESDPFMKLQVLQQATTLSFW 720 MSLTFPKN TE DPF+KLQVLQ+ATTLSFW Sbjct: 74 MSLTFPKNFFTERDPFIKLQVLQEATTLSFW 104
BLAST of mRNA_P-lacustris_contig101.179.1 vs. uniprot
Match: A0A3C2CGI7_9BACT (Uncharacterized protein n=1 Tax=Candidatus Nomurabacteria bacterium TaxID=2052152 RepID=A0A3C2CGI7_9BACT) HSP 1 Score: 54.7 bits (130), Expect = 1.370e-5 Identity = 26/88 (29.55%), Postives = 49/88 (55.68%), Query Frame = 2 Query: 470 WRVFKEQAKRRSIQVSINFDEYSSIVRTACWYCGQ------YTYRGY-----SGVDRMQNAGTYQKDNVVACCRTCNFMKGSLSVTEF 700 ++ + + AK R + + +E+ S++ +C+YC + + RG +G+DR+ ++ Y +NVV CC+ CN+ K +SV EF Sbjct: 83 FKTYADSAKNRCLSFELTKEEFVSLISKSCFYCNEPPSERWHEARGNGHMLSNGLDRIDSSKGYTTNNVVPCCKKCNYAKKQMSVEEF 170
BLAST of mRNA_P-lacustris_contig101.179.1 vs. uniprot
Match: A0A6H5JQZ5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JQZ5_9PHAE) HSP 1 Score: 55.8 bits (133), Expect = 1.890e-5 Identity = 26/35 (74.29%), Postives = 29/35 (82.86%), Query Frame = -2 Query: 280 IRLLSYSGAVTTTNPFRTGPVGLVVDFLADIHPLS 384 +R +SYSGA TTTNP RTGPVGLV FL +IHPLS Sbjct: 1 MRRMSYSGAFTTTNPSRTGPVGLVDGFLVEIHPLS 35
BLAST of mRNA_P-lacustris_contig101.179.1 vs. uniprot
Match: A0A0F9F6T2_9ZZZZ (Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9F6T2_9ZZZZ) HSP 1 Score: 55.1 bits (131), Expect = 2.600e-5 Identity = 26/82 (31.71%), Postives = 45/82 (54.88%), Query Frame = 2 Query: 488 QAKRRSIQVSINFDEYSSIVRTACWYCGQYTYR---------GY--SGVDRMQNAGTYQKDNVVACCRTCNFMKGSLSVTEF 700 ++K+R I +++FD + + C+YCG Y +G+DR+ N Y +DNVV CC+ CN+ K ++S+ +F Sbjct: 204 RSKKRKINFTLSFDTFVELTSQHCFYCGTKPSNITVNEAGNGDYVSNGIDRVDNNKGYIEDNVVPCCKVCNYAKNTMSLDQF 285 The following BLAST results are available for this feature:
BLAST of mRNA_P-lacustris_contig101.179.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 9 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-lacustris_contig101.179.1 >prot_P-lacustris_contig101.179.1 ID=prot_P-lacustris_contig101.179.1|Name=mRNA_P-lacustris_contig101.179.1|organism=Pleurocladia lacustris SAG_25_93|type=polypeptide|length=143bp MSARKSTTKPTGPVRNGFVVVTAPEYDKRRIRALQNKRYRRTAVYEKHLEback to top mRNA from alignment at P-lacustris_contig101:15404..17351- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-lacustris_contig101.179.1 ID=mRNA_P-lacustris_contig101.179.1|Name=mRNA_P-lacustris_contig101.179.1|organism=Pleurocladia lacustris SAG_25_93|type=mRNA|length=1948bp|location=Sequence derived from alignment at P-lacustris_contig101:15404..17351- (Pleurocladia lacustris SAG_25_93)back to top Coding sequence (CDS) from alignment at P-lacustris_contig101:15404..17351- >mRNA_P-lacustris_contig101.179.1 ID=mRNA_P-lacustris_contig101.179.1|Name=mRNA_P-lacustris_contig101.179.1|organism=Pleurocladia lacustris SAG_25_93|type=CDS|length=858bp|location=Sequence derived from alignment at P-lacustris_contig101:15404..17351- (Pleurocladia lacustris SAG_25_93)back to top |