mRNA_P-lacustris_contig1008.167.1 (mRNA) Pleurocladia lacustris SAG_25_93
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_P-lacustris_contig1008.167.1 vs. uniprot
Match: A0A6H5JFN2_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFN2_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 1.110e-6 Identity = 25/42 (59.52%), Postives = 32/42 (76.19%), Query Frame = 1 Query: 76 SEPNSGHQFSFAAQARQHGLVVTGELQPCGGCVEAKGKRAGV 201 S+PN +F A+QHGL +TG LQPCGGC++AKGK+AGV Sbjct: 27 SQPN---EFLLRELAKQHGLRLTGVLQPCGGCLQAKGKKAGV 65
BLAST of mRNA_P-lacustris_contig1008.167.1 vs. uniprot
Match: A0A6H5J7L5_9PHAE (Integrase catalytic domain-containing protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J7L5_9PHAE) HSP 1 Score: 52.4 bits (124), Expect = 2.790e-6 Identity = 22/36 (61.11%), Postives = 29/36 (80.56%), Query Frame = 1 Query: 94 HQFSFAAQARQHGLVVTGELQPCGGCVEAKGKRAGV 201 ++F A+QHGL +TG LQPCGGC++AKGK+AGV Sbjct: 49 NEFLLRELAKQHGLRLTGVLQPCGGCLQAKGKKAGV 84
BLAST of mRNA_P-lacustris_contig1008.167.1 vs. uniprot
Match: A0A6H5JEZ3_9PHAE (Integrase catalytic domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JEZ3_9PHAE) HSP 1 Score: 52.4 bits (124), Expect = 3.300e-6 Identity = 22/36 (61.11%), Postives = 29/36 (80.56%), Query Frame = 1 Query: 94 HQFSFAAQARQHGLVVTGELQPCGGCVEAKGKRAGV 201 ++F A+QHGL +TG LQPCGGC++AKGK+AGV Sbjct: 49 NEFLLRELAKQHGLRLTGVLQPCGGCLQAKGKKAGV 84
BLAST of mRNA_P-lacustris_contig1008.167.1 vs. uniprot
Match: A0A6H5KS66_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KS66_9PHAE) HSP 1 Score: 52.4 bits (124), Expect = 3.360e-6 Identity = 22/36 (61.11%), Postives = 29/36 (80.56%), Query Frame = 1 Query: 94 HQFSFAAQARQHGLVVTGELQPCGGCVEAKGKRAGV 201 ++F A+QHGL +TG LQPCGGC++AKGK+AGV Sbjct: 49 NEFLLRELAKQHGLRLTGVLQPCGGCLQAKGKKAGV 84
BLAST of mRNA_P-lacustris_contig1008.167.1 vs. uniprot
Match: A0A6H5KKG5_9PHAE (Integrase catalytic domain-containing protein n=6 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KKG5_9PHAE) HSP 1 Score: 52.4 bits (124), Expect = 3.400e-6 Identity = 22/36 (61.11%), Postives = 29/36 (80.56%), Query Frame = 1 Query: 94 HQFSFAAQARQHGLVVTGELQPCGGCVEAKGKRAGV 201 ++F A+QHGL +TG LQPCGGC++AKGK+AGV Sbjct: 49 NEFLLRELAKQHGLRLTGVLQPCGGCLQAKGKKAGV 84
BLAST of mRNA_P-lacustris_contig1008.167.1 vs. uniprot
Match: A0A6H5K2R1_9PHAE (Integrase catalytic domain-containing protein n=3 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K2R1_9PHAE) HSP 1 Score: 52.4 bits (124), Expect = 3.400e-6 Identity = 22/36 (61.11%), Postives = 29/36 (80.56%), Query Frame = 1 Query: 94 HQFSFAAQARQHGLVVTGELQPCGGCVEAKGKRAGV 201 ++F A+QHGL +TG LQPCGGC++AKGK+AGV Sbjct: 49 NEFLLRELAKQHGLRLTGVLQPCGGCLQAKGKKAGV 84
BLAST of mRNA_P-lacustris_contig1008.167.1 vs. uniprot
Match: A0A6H5KSN7_9PHAE (Integrase catalytic domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KSN7_9PHAE) HSP 1 Score: 52.4 bits (124), Expect = 3.430e-6 Identity = 22/36 (61.11%), Postives = 29/36 (80.56%), Query Frame = 1 Query: 94 HQFSFAAQARQHGLVVTGELQPCGGCVEAKGKRAGV 201 ++F A+QHGL +TG LQPCGGC++AKGK+AGV Sbjct: 692 NEFLLRELAKQHGLRLTGVLQPCGGCLQAKGKKAGV 727
BLAST of mRNA_P-lacustris_contig1008.167.1 vs. uniprot
Match: A0A6H5K6Z8_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K6Z8_9PHAE) HSP 1 Score: 50.8 bits (120), Expect = 1.180e-5 Identity = 21/36 (58.33%), Postives = 29/36 (80.56%), Query Frame = 1 Query: 94 HQFSFAAQARQHGLVVTGELQPCGGCVEAKGKRAGV 201 ++F A+QHGL +TG L+PCGGC++AKGK+AGV Sbjct: 49 NEFLLRELAKQHGLRLTGVLRPCGGCLQAKGKKAGV 84
BLAST of mRNA_P-lacustris_contig1008.167.1 vs. uniprot
Match: A0A6H5K0D0_9PHAE (Integrase catalytic domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K0D0_9PHAE) HSP 1 Score: 50.1 bits (118), Expect = 2.160e-5 Identity = 21/35 (60.00%), Postives = 27/35 (77.14%), Query Frame = 1 Query: 94 HQFSFAAQARQHGLVVTGELQPCGGCVEAKGKRAG 198 ++F A+QHGL +TG LQPCGGC++AKGK AG Sbjct: 30 NEFLLLELAKQHGLRLTGVLQPCGGCLQAKGKNAG 64
BLAST of mRNA_P-lacustris_contig1008.167.1 vs. uniprot
Match: A0A6H5JHE8_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHE8_9PHAE) HSP 1 Score: 49.7 bits (117), Expect = 3.000e-5 Identity = 21/36 (58.33%), Postives = 28/36 (77.78%), Query Frame = 1 Query: 94 HQFSFAAQARQHGLVVTGELQPCGGCVEAKGKRAGV 201 ++F A+QHGL +TG LQPCGGC++AKGK+A V Sbjct: 407 NEFLLLELAKQHGLRLTGVLQPCGGCLQAKGKKADV 442 The following BLAST results are available for this feature:
BLAST of mRNA_P-lacustris_contig1008.167.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 12 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-lacustris_contig1008.167.1 >prot_P-lacustris_contig1008.167.1 ID=prot_P-lacustris_contig1008.167.1|Name=mRNA_P-lacustris_contig1008.167.1|organism=Pleurocladia lacustris SAG_25_93|type=polypeptide|length=68bp MPFDYQGSCVDLSPTPPPAAEPHAFSEPNSGHQFSFAAQARQHGLVVTGEback to top mRNA from alignment at P-lacustris_contig1008:40469..40672+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-lacustris_contig1008.167.1 ID=mRNA_P-lacustris_contig1008.167.1|Name=mRNA_P-lacustris_contig1008.167.1|organism=Pleurocladia lacustris SAG_25_93|type=mRNA|length=204bp|location=Sequence derived from alignment at P-lacustris_contig1008:40469..40672+ (Pleurocladia lacustris SAG_25_93)back to top Coding sequence (CDS) from alignment at P-lacustris_contig1008:40469..40672+ >mRNA_P-lacustris_contig1008.167.1 ID=mRNA_P-lacustris_contig1008.167.1|Name=mRNA_P-lacustris_contig1008.167.1|organism=Pleurocladia lacustris SAG_25_93|type=CDS|length=408bp|location=Sequence derived from alignment at P-lacustris_contig1008:40469..40672+ (Pleurocladia lacustris SAG_25_93)back to top |