mRNA_P-lacustris_contig1000.119.1 (mRNA) Pleurocladia lacustris SAG_25_93
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_P-lacustris_contig1000.119.1 vs. uniprot
Match: A0A6H5JYK1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JYK1_9PHAE) HSP 1 Score: 123 bits (308), Expect = 1.150e-30 Identity = 59/77 (76.62%), Postives = 61/77 (79.22%), Query Frame = 3 Query: 375 LFPFITKGAVGNANTGGSTHKEVKKSAASASGRDNPVHMFRAWNDNHGLKALCDGVRWRVRGREDGVEVEKELTAGP 605 F F TKGAVGNAN G S HKEVKKSA SASGRDNPVH+FR WND LKALCDGVRW +GR GVEV KELTAGP Sbjct: 24 FFFFRTKGAVGNANFGESKHKEVKKSATSASGRDNPVHIFRTWNDTQALKALCDGVRWSAKGRVGGVEVTKELTAGP 100 The following BLAST results are available for this feature:
BLAST of mRNA_P-lacustris_contig1000.119.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-lacustris_contig1000.119.1 >prot_P-lacustris_contig1000.119.1 ID=prot_P-lacustris_contig1000.119.1|Name=mRNA_P-lacustris_contig1000.119.1|organism=Pleurocladia lacustris SAG_25_93|type=polypeptide|length=107bp MSHLRYYAAGMSHRPVLVGTTNPPIPTSPGLFPFITKGAVGNANTGGSTHback to top mRNA from alignment at P-lacustris_contig1000:28745..29349+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-lacustris_contig1000.119.1 ID=mRNA_P-lacustris_contig1000.119.1|Name=mRNA_P-lacustris_contig1000.119.1|organism=Pleurocladia lacustris SAG_25_93|type=mRNA|length=605bp|location=Sequence derived from alignment at P-lacustris_contig1000:28745..29349+ (Pleurocladia lacustris SAG_25_93)back to top Coding sequence (CDS) from alignment at P-lacustris_contig1000:28745..29349+ >mRNA_P-lacustris_contig1000.119.1 ID=mRNA_P-lacustris_contig1000.119.1|Name=mRNA_P-lacustris_contig1000.119.1|organism=Pleurocladia lacustris SAG_25_93|type=CDS|length=642bp|location=Sequence derived from alignment at P-lacustris_contig1000:28745..29349+ (Pleurocladia lacustris SAG_25_93)back to top |