mRNA_P-wetherbeei_contig9992.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9992.1.1 vs. uniprot
Match: D8LE94_ECTSI (Complex1_LYR_dom domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LE94_ECTSI) HSP 1 Score: 84.7 bits (208), Expect = 1.570e-19 Identity = 40/71 (56.34%), Postives = 55/71 (77.46%), Query Frame = 1 Query: 22 QSPKGQAIRRLLRAEFDKNRGEEDPAKIEELKSNAVRGLSNYVLQESGSNDPRLRKRMDTMRQSIVRELRE 234 +SPKGQ +R +LR EF KN GE DP KIE LK A+RGLSNY++ ESGSNDP+L+KRM+ ++ + +L++ Sbjct: 28 KSPKGQQLRLILRTEFKKNMGETDPVKIEALKGGAIRGLSNYLVHESGSNDPQLKKRMEAVKTHALADLKQ 98
BLAST of mRNA_P-wetherbeei_contig9992.1.1 vs. uniprot
Match: W7T1T1_9STRA (Complex1_LYR_dom domain-containing protein n=2 Tax=Monodopsidaceae TaxID=425072 RepID=W7T1T1_9STRA) HSP 1 Score: 71.6 bits (174), Expect = 4.230e-14 Identity = 33/73 (45.21%), Postives = 53/73 (72.60%), Query Frame = 1 Query: 22 QSPKGQAIRRLLRAEFDKNRGEEDPAKIEELKSNAVRGLSNYVLQESGSNDPRLRKRMDTMRQSIVRELREDA 240 +SPKG A+R++LR+EF KN +D ++E+LK NA RGL+NY+L ESGS +P++R RM+ ++++ +A Sbjct: 36 KSPKGIALRKMLRSEFKKNAAVDDAKQVEQLKMNAARGLANYLLYESGSKEPKIRARMNKTTSDMIKQCMNNA 108
BLAST of mRNA_P-wetherbeei_contig9992.1.1 vs. uniprot
Match: D0NYH0_PHYIT (Complex1_LYR_dom domain-containing protein n=3 Tax=Phytophthora TaxID=4783 RepID=D0NYH0_PHYIT) HSP 1 Score: 68.9 bits (167), Expect = 2.380e-13 Identity = 36/58 (62.07%), Postives = 44/58 (75.86%), Query Frame = 1 Query: 25 SPKGQAIRRLLRAEFDKNRGEEDPAKIEELKSNAVRGLSNYVLQESGSNDPRLRKRMD 198 S KGQAIR L+R EFDK R E DP KIE LK+NAVRGLSNY++ + S D RL++ M+ Sbjct: 29 SKKGQAIRELVRREFDKGRSETDPEKIEALKANAVRGLSNYLMLANSSKDQRLQEAMN 86
BLAST of mRNA_P-wetherbeei_contig9992.1.1 vs. uniprot
Match: W2MP41_PHYPR (Complex1_LYR_dom domain-containing protein n=7 Tax=Phytophthora parasitica TaxID=4792 RepID=W2MP41_PHYPR) HSP 1 Score: 68.6 bits (166), Expect = 2.430e-13 Identity = 36/59 (61.02%), Postives = 43/59 (72.88%), Query Frame = 1 Query: 22 QSPKGQAIRRLLRAEFDKNRGEEDPAKIEELKSNAVRGLSNYVLQESGSNDPRLRKRMD 198 QS KGQAI+ L+R EFDK R E DP KIE LK+NAVRGLSNY++ + S D RL M+ Sbjct: 15 QSKKGQAIKELVRREFDKGRSETDPEKIEALKANAVRGLSNYLMLANSSKDQRLHDAMN 73
BLAST of mRNA_P-wetherbeei_contig9992.1.1 vs. uniprot
Match: A0A482SGE8_9ARCH (LYR motif-containing protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482SGE8_9ARCH) HSP 1 Score: 69.3 bits (168), Expect = 3.880e-13 Identity = 36/71 (50.70%), Postives = 52/71 (73.24%), Query Frame = 1 Query: 22 QSPKGQAIRRLLRAEFDKNRGEEDPAKIEELKSNAVRGLSNYVLQESGSNDPRLRKRMDTMRQSIVRELRE 234 +S KG+ IRR+LR EF KN EDPAKIE+LKSNAVRGL+NY++ ES + D +L+K+ + + +++ E Sbjct: 50 RSQKGENIRRVLRHEFRKNAKLEDPAKIEQLKSNAVRGLANYLMIESATKDTKLQKQANIFAEKEIKDANE 120
BLAST of mRNA_P-wetherbeei_contig9992.1.1 vs. uniprot
Match: A0A7S2W976_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2W976_9STRA) HSP 1 Score: 68.6 bits (166), Expect = 6.930e-13 Identity = 36/58 (62.07%), Postives = 45/58 (77.59%), Query Frame = 1 Query: 22 QSPKGQAIRRLLRAEFDKNRGEEDPAKIEELKSNAVRGLSNYVLQESGSNDPRLRKRM 195 QS KGQA+R + EF K++ EDP +IE L++NAVR LSNY+L ESGS DPRLR+RM Sbjct: 38 QSAKGQALRMTVSMEFRKHQHVEDPKEIEALRANAVRALSNYMLYESGSKDPRLRERM 95
BLAST of mRNA_P-wetherbeei_contig9992.1.1 vs. uniprot
Match: A0A0W8DJD0_PHYNI (Complex1_LYR_dom domain-containing protein n=3 Tax=Phytophthora TaxID=4783 RepID=A0A0W8DJD0_PHYNI) HSP 1 Score: 66.6 bits (161), Expect = 2.520e-12 Identity = 35/58 (60.34%), Postives = 42/58 (72.41%), Query Frame = 1 Query: 25 SPKGQAIRRLLRAEFDKNRGEEDPAKIEELKSNAVRGLSNYVLQESGSNDPRLRKRMD 198 S KGQAI+ L+R EFDK R E DP KIE LK+NAVRGLSNY++ + S D RL M+ Sbjct: 29 SKKGQAIKELVRREFDKGRSETDPEKIEALKANAVRGLSNYLMLANSSKDQRLHDAMN 86
BLAST of mRNA_P-wetherbeei_contig9992.1.1 vs. uniprot
Match: G4ZUA9_PHYSP (Complex1_LYR_dom domain-containing protein n=11 Tax=Phytophthora TaxID=4783 RepID=G4ZUA9_PHYSP) HSP 1 Score: 65.5 bits (158), Expect = 5.480e-12 Identity = 34/58 (58.62%), Postives = 42/58 (72.41%), Query Frame = 1 Query: 25 SPKGQAIRRLLRAEFDKNRGEEDPAKIEELKSNAVRGLSNYVLQESGSNDPRLRKRMD 198 S KGQAI+ L+R EF+K R E DP KIE LK+NAVRGLSNY++ + S D RL M+ Sbjct: 29 SKKGQAIKELVRREFEKGRSETDPEKIEALKANAVRGLSNYLMLANSSKDQRLHNAMN 86
BLAST of mRNA_P-wetherbeei_contig9992.1.1 vs. uniprot
Match: A0A2D4CFG3_PYTIN (Complex1_LYR_dom domain-containing protein n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4CFG3_PYTIN) HSP 1 Score: 64.3 bits (155), Expect = 1.520e-11 Identity = 33/57 (57.89%), Postives = 42/57 (73.68%), Query Frame = 1 Query: 25 SPKGQAIRRLLRAEFDKNRGEEDPAKIEELKSNAVRGLSNYVLQESGSNDPRLRKRM 195 S KGQAI+ L+R EF+K R E DP KIE LK+NAVRGLSNY++ + S D L++ M Sbjct: 29 SKKGQAIKSLIRREFEKGRSETDPEKIEALKANAVRGLSNYLVMANSSKDKNLQQAM 85
BLAST of mRNA_P-wetherbeei_contig9992.1.1 vs. uniprot
Match: A0A0N7L4H7_PLAHL (Complex 1 LYR protein n=1 Tax=Plasmopara halstedii TaxID=4781 RepID=A0A0N7L4H7_PLAHL) HSP 1 Score: 63.9 bits (154), Expect = 2.150e-11 Identity = 35/58 (60.34%), Postives = 42/58 (72.41%), Query Frame = 1 Query: 25 SPKGQAIRRLLRAEFDKNRGEEDPAKIEELKSNAVRGLSNYVLQESGSNDPRLRKRMD 198 S KGQAI+ L+R EFDK R E D KIE LK+NAVRGLSNY++ + S D RLR M+ Sbjct: 28 SKKGQAIKDLIRREFDKGRSEVDIEKIETLKANAVRGLSNYLMLANSSKDQRLRDAMN 85 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9992.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9992.1.1 >prot_P-wetherbeei_contig9992.1.1 ID=prot_P-wetherbeei_contig9992.1.1|Name=mRNA_P-wetherbeei_contig9992.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=84bp MHLTPSPQSPKGQAIRRLLRAEFDKNRGEEDPAKIEELKSNAVRGLSNYVback to top mRNA from alignment at P-wetherbeei_contig9992:31..598+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9992.1.1 ID=mRNA_P-wetherbeei_contig9992.1.1|Name=mRNA_P-wetherbeei_contig9992.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=568bp|location=Sequence derived from alignment at P-wetherbeei_contig9992:31..598+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9992:31..598+ >mRNA_P-wetherbeei_contig9992.1.1 ID=mRNA_P-wetherbeei_contig9992.1.1|Name=mRNA_P-wetherbeei_contig9992.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=252bp|location=Sequence derived from alignment at P-wetherbeei_contig9992:31..598+ (Phaeothamnion wetherbeei SAG_119_79)back to top |