prot_P-wetherbeei_contig9962.3.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9962.3.1 vs. uniprot
Match: A0A7S4A0V2_9STRA (Hypothetical protein n=2 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A7S4A0V2_9STRA) HSP 1 Score: 56.2 bits (134), Expect = 1.440e-6 Identity = 27/53 (50.94%), Postives = 34/53 (64.15%), Query Frame = 0 Query: 1 LDSRLATASELFNDCAYPYCLFECCLALLASCGSDEPSLVAQLWTSLIFRETP 53 L+SRL SEL+ND A Y +++ CLA L CG D+ L +LWTSLI R P Sbjct: 1454 LESRLVGVSELYNDVASRYGMWDVCLATLKVCGHDDEPLAVKLWTSLIKRLVP 1506
BLAST of mRNA_P-wetherbeei_contig9962.3.1 vs. uniprot
Match: F0YFH0_AURAN (Uncharacterized protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0YFH0_AURAN) HSP 1 Score: 55.5 bits (132), Expect = 2.680e-6 Identity = 28/68 (41.18%), Postives = 38/68 (55.88%), Query Frame = 0 Query: 1 LDSRLATASELFNDCAYPYCLFECCLALLASCGSDEPSLVAQLWTSLIFRETPRPIQYGAGTASAADA 68 L+ RL SEL+ND A Y +++ CL L CG D+ L +LWTSL+ R PR + + A DA Sbjct: 1533 LEERLVGVSELYNDVASRYGMWDLCLVTLKVCGHDDEPLAVKLWTSLLRRLVPRRARDASAQARLGDA 1600 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9962.3.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig9962.3.1 ID=prot_P-wetherbeei_contig9962.3.1|Name=mRNA_P-wetherbeei_contig9962.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=130bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|