prot_P-wetherbeei_contig9939.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9939.1.1 vs. uniprot
Match: D7G565_ECTSI (Protein-ribulosamine 3-kinase n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G565_ECTSI) HSP 1 Score: 86.7 bits (213), Expect = 1.630e-17 Identity = 42/57 (73.68%), Postives = 45/57 (78.95%), Query Frame = 0 Query: 65 QAIAATGCLRTPRPLATGELPLGGSFLLMGFEPFIPFGQSIPTVIAELAEGLAKMHL 121 +AI TGCLR P+PLA G LPLGGSFLLM PFIPFGQSIP V+ LAEGLA MHL Sbjct: 160 EAILETGCLRAPKPLALGTLPLGGSFLLMEHMPFIPFGQSIPEVLRNLAEGLAAMHL 216
BLAST of mRNA_P-wetherbeei_contig9939.1.1 vs. uniprot
Match: A0A835YJQ4_9STRA (Protein-ribulosamine 3-kinase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YJQ4_9STRA) HSP 1 Score: 81.3 bits (199), Expect = 1.290e-15 Identity = 38/57 (66.67%), Postives = 46/57 (80.70%), Query Frame = 0 Query: 65 QAIAATGCLRTPRPLATGELPLGGSFLLMGFEPFIPFGQSIPTVIAELAEGLAKMHL 121 QAI + CLR P PL+ G LPLGGS+LLM + P IPFGQSIP+V+ +LAEGLA+MHL Sbjct: 132 QAIRSMNCLRAPEPLSCGALPLGGSYLLMEYLPCIPFGQSIPSVLQQLAEGLAQMHL 188
BLAST of mRNA_P-wetherbeei_contig9939.1.1 vs. uniprot
Match: A0A7S2VN62_9DINO (Protein-ribulosamine 3-kinase (Fragment) n=1 Tax=Brandtodinium nutricula TaxID=1333877 RepID=A0A7S2VN62_9DINO) HSP 1 Score: 56.6 bits (135), Expect = 3.470e-7 Identity = 39/92 (42.39%), Postives = 48/92 (52.17%), Query Frame = 0 Query: 30 LLRNGARALARYNRNHGFFIAFPFHAFPSATPIASQAIAATGC-LRTPRPLATGELPLGGSFLLMGFEPFIPFGQSIPTVIAELAEGLAKMH 120 L R G LA+ NR + A + + A AA G + PRP A G LP GGSFL+M F F+PFG SIP V+ L GLA +H Sbjct: 28 LRRGGGDLLAKVNRAPQDVLE------AEAAGLEALAAAAEGTGVVVPRPHALGSLP-GGSFLVMDFLQFVPFGPSIPAVLERLGRGLAAIH 112
BLAST of mRNA_P-wetherbeei_contig9939.1.1 vs. uniprot
Match: A0A813GVC0_POLGL (Protein-ribulosamine 3-kinase n=2 Tax=Polarella glacialis TaxID=89957 RepID=A0A813GVC0_POLGL) HSP 1 Score: 50.8 bits (120), Expect = 7.310e-5 Identity = 26/49 (53.06%), Postives = 32/49 (65.31%), Query Frame = 0 Query: 73 LRTPRPLATGELPLG-GSFLLMGFEPFIPFGQSIPTVIAELAEGLAKMH 120 L P P GE+P G GSFL+M F FIPFG SIP V+ +L + LA +H Sbjct: 165 LVVPAPHTLGEMPEGRGSFLVMDFLRFIPFGPSIPEVVEKLGQSLALLH 213 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9939.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig9939.1.1 ID=prot_P-wetherbeei_contig9939.1.1|Name=mRNA_P-wetherbeei_contig9939.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=121bpback to top |