prot_P-wetherbeei_contig9937.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9937.1.1 vs. uniprot
Match: A0A0M9YNM0_9ACTN (Endonuclease VII n=1 Tax=Streptomyces sp. WM4235 TaxID=1415551 RepID=A0A0M9YNM0_9ACTN) HSP 1 Score: 52.4 bits (124), Expect = 3.500e-5 Identity = 30/90 (33.33%), Postives = 50/90 (55.56%), Query Frame = 0 Query: 15 VEKLCKSCDTNKPTSAFNKDKTHSDGLRSSCKSCAK---KALANPNRRRIVH-VARPPGQKRCPKCRNNKPHEAFSPDITSKDGFHAHCK 100 + K C C ++P S + +++ +DGL+S +SC+ KA R + V P G KRCP+CR KPH + + T+ DG+ ++C+ Sbjct: 4 ITKRCSRCKQDRPRSEYASNRSIADGLQSYGRSCSADYYKARQEAKGRTVREKVTVPSGHKRCPQCREVKPHSEWERNKTTSDGWSSYCR 93 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9937.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig9937.1.1 ID=prot_P-wetherbeei_contig9937.1.1|Name=mRNA_P-wetherbeei_contig9937.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=172bpback to top |