prot_P-wetherbeei_contig9743.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9743.1.1 vs. uniprot
Match: A0A1W5CYZ0_9LECA (WSC domain-containing protein n=1 Tax=Lasallia pustulata TaxID=136370 RepID=A0A1W5CYZ0_9LECA) HSP 1 Score: 61.6 bits (148), Expect = 4.360e-8 Identity = 30/74 (40.54%), Postives = 39/74 (52.70%), Query Frame = 0 Query: 50 ATAKFRVTCETFASGAFMDPLEYPGKRSSHRHDIGGSLGFNANRVNAKAMQLNVSTCDILGDFSNYWAPTFYFH 123 A A +R+ C+T DP+ PGK S H H I G GF+ A S+C ++GD SNYW PT Y+H Sbjct: 21 AVAFWRLPCKTPIVVERADPVISPGKPSGHVHTIMGGNGFSFTMDYASTQSSTCSSCTVIGDKSNYWVPTLYYH 94
BLAST of mRNA_P-wetherbeei_contig9743.1.1 vs. uniprot
Match: A0A5M8PEJ8_9LECA (Uncharacterized protein n=1 Tax=Lasallia pustulata TaxID=136370 RepID=A0A5M8PEJ8_9LECA) HSP 1 Score: 61.6 bits (148), Expect = 4.590e-8 Identity = 30/74 (40.54%), Postives = 39/74 (52.70%), Query Frame = 0 Query: 50 ATAKFRVTCETFASGAFMDPLEYPGKRSSHRHDIGGSLGFNANRVNAKAMQLNVSTCDILGDFSNYWAPTFYFH 123 A A +R+ C+T DP+ PGK S H H I G GF+ A S+C ++GD SNYW PT Y+H Sbjct: 21 AVAFWRLPCKTPIVVERADPVISPGKPSGHVHTIMGGNGFSFTMDYASTQSSTCSSCTVIGDKSNYWVPTLYYH 94 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9743.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig9743.1.1 ID=prot_P-wetherbeei_contig9743.1.1|Name=mRNA_P-wetherbeei_contig9743.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=163bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|