prot_P-wetherbeei_contig9711.3.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9711.3.1 vs. uniprot
Match: A0A6H5KJ20_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJ20_9PHAE) HSP 1 Score: 67.4 bits (163), Expect = 1.840e-11 Identity = 36/71 (50.70%), Postives = 44/71 (61.97%), Query Frame = 0 Query: 1 DHAWFLFQFVHVALNAIYICSVLGLPTLHAVYSNAATGDLALLCVFSFLWGSGTLFYVLGIDLLGAGLGVS 71 ++ W F LNAI+ SV+G L AVY A+ DL L+C FSFLWGSGT + LGI LLGAG G + Sbjct: 47 ENVWLPFIIHSTVLNAIFCVSVVGPDALLAVYREASPVDLGLVCTFSFLWGSGTACFSLGIQLLGAGPGTA 117 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9711.3.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig9711.3.1 ID=prot_P-wetherbeei_contig9711.3.1|Name=mRNA_P-wetherbeei_contig9711.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=71bpback to top |