prot_P-wetherbeei_contig1226.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1226.2.1 vs. uniprot
Match: D8LRV6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LRV6_ECTSI) HSP 1 Score: 61.2 bits (147), Expect = 1.030e-8 Identity = 26/49 (53.06%), Postives = 40/49 (81.63%), Query Frame = 0 Query: 1 MDADYLKRTVGDPLSEALARMVVAQPTDAVGYIGDYLLNYVAQRKMEIR 49 MDA++LKRTVG+PLS+AL +VVAQP D + +IG+ LL+++ +R+ E + Sbjct: 12 MDAEFLKRTVGEPLSDALTALVVAQPADPIEFIGEALLDFIKRREAEAK 60
BLAST of mRNA_P-wetherbeei_contig1226.2.1 vs. uniprot
Match: A0A1V9YYG1_9STRA (Flagella associated protein n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9YYG1_9STRA) HSP 1 Score: 56.2 bits (134), Expect = 5.950e-7 Identity = 26/44 (59.09%), Postives = 32/44 (72.73%), Query Frame = 0 Query: 2 DADYLKRTVGDPLSEALARMVVAQPTDAVGYIGDYLLNYVAQRK 45 D YLK TVG+PLSEALA++ + QP D + Y+G YLL YVA K Sbjct: 10 DFVYLKTTVGNPLSEALAQLALDQPEDPIEYVGKYLLKYVANEK 53 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1226.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig1226.2.1 ID=prot_P-wetherbeei_contig1226.2.1|Name=mRNA_P-wetherbeei_contig1226.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=106bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|