mRNA_P-wetherbeei_contig12191.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12191.2.1 vs. uniprot
Match: A0A6H5JQJ4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JQJ4_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 4.740e-12 Identity = 34/59 (57.63%), Postives = 44/59 (74.58%), Query Frame = 1 Query: 4 EEDVLLLEERCNDVSVATRKVAAAAITGLLRARPADAFLQIAWVRALLPLAMDPEASCQ 180 E D LL+ERCND+S++TRK A A++ LL RP+D LQ AWV ++LPLA DPE +CQ Sbjct: 548 EADFELLQERCNDISLSTRKAAMGALSSLLMLRPSDETLQKAWVSSVLPLAGDPEQTCQ 606
BLAST of mRNA_P-wetherbeei_contig12191.2.1 vs. uniprot
Match: D7FP86_ECTSI (Cnd1 domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FP86_ECTSI) HSP 1 Score: 67.8 bits (164), Expect = 8.960e-12 Identity = 34/59 (57.63%), Postives = 44/59 (74.58%), Query Frame = 1 Query: 4 EEDVLLLEERCNDVSVATRKVAAAAITGLLRARPADAFLQIAWVRALLPLAMDPEASCQ 180 E D LL+ERCND+S++TRK A A++ LL RP+D LQ AWV ++LPLA DPE +CQ Sbjct: 684 EADFELLQERCNDMSLSTRKAAMGALSSLLMLRPSDESLQKAWVSSVLPLAGDPEQTCQ 742 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12191.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig12191.2.1 >prot_P-wetherbeei_contig12191.2.1 ID=prot_P-wetherbeei_contig12191.2.1|Name=mRNA_P-wetherbeei_contig12191.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=60bp FEEDVLLLEERCNDVSVATRKVAAAAITGLLRARPADAFLQIAWVRALLPback to top mRNA from alignment at P-wetherbeei_contig12191:1763..1942- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig12191.2.1 ID=mRNA_P-wetherbeei_contig12191.2.1|Name=mRNA_P-wetherbeei_contig12191.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=180bp|location=Sequence derived from alignment at P-wetherbeei_contig12191:1763..1942- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig12191:1763..1942- >mRNA_P-wetherbeei_contig12191.2.1 ID=mRNA_P-wetherbeei_contig12191.2.1|Name=mRNA_P-wetherbeei_contig12191.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=180bp|location=Sequence derived from alignment at P-wetherbeei_contig12191:1763..1942- (Phaeothamnion wetherbeei SAG_119_79)back to top |