mRNA_P-wetherbeei_contig12184.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12184.1.1 vs. uniprot
Match: A0A2I1D1F6_9EURO (PGA_cap domain-containing protein n=1 Tax=Aspergillus campestris IBT 28561 TaxID=1392248 RepID=A0A2I1D1F6_9EURO) HSP 1 Score: 103 bits (257), Expect = 1.000e-24 Identity = 48/74 (64.86%), Postives = 56/74 (75.68%), Query Frame = 1 Query: 1 GPNYAWQPSPAIRSLARILIDG-GVDVIHGHSSHHIQACRLQGVEIYKGKPIFYGLGDFVDDYAVDYSYRNDHG 219 GPNY WQP+ IR LA LID GVD++HGHS+HH+Q GVE++KGKPI YG GDFVDDYAVD +RND G Sbjct: 216 GPNYTWQPASEIRHLAHFLIDECGVDIVHGHSAHHVQ-----GVEVHKGKPIIYGCGDFVDDYAVDRRFRNDLG 284
BLAST of mRNA_P-wetherbeei_contig12184.1.1 vs. uniprot
Match: A0A6A6JYW2_9PLEO (Putative polyglutamate biosynthesis protein n=1 Tax=Westerdykella ornata TaxID=318751 RepID=A0A6A6JYW2_9PLEO) HSP 1 Score: 102 bits (254), Expect = 2.590e-24 Identity = 50/72 (69.44%), Postives = 55/72 (76.39%), Query Frame = 1 Query: 1 GPNYAWQPSPAIRSLARILIDG-GVDVIHGHSSHHIQACRLQGVEIYKGKPIFYGLGDFVDDYAVDYSYRND 213 GPNY+W PS IRSLA LID GVD+IHGHSSHHIQ GVE+YK K I YG GDFVDDYA+D +YRND Sbjct: 218 GPNYSWSPSEEIRSLAHYLIDECGVDIIHGHSSHHIQ-----GVEVYKQKLIIYGCGDFVDDYAIDKTYRND 284
BLAST of mRNA_P-wetherbeei_contig12184.1.1 vs. uniprot
Match: A0A2I2FND6_9EURO (PGA_cap domain-containing protein n=1 Tax=Aspergillus candidus TaxID=41067 RepID=A0A2I2FND6_9EURO) HSP 1 Score: 102 bits (254), Expect = 3.870e-24 Identity = 47/76 (61.84%), Postives = 57/76 (75.00%), Query Frame = 1 Query: 1 GPNYAWQPSPAIRSLARILIDG-GVDVIHGHSSHHIQACRLQGVEIYKGKPIFYGLGDFVDDYAVDYSYRNDHGMI 225 GPNY WQP+ I+ LA LID GVD++HGHS+HH+Q GVE++KGKPI YG GDFVDDYAVD +RND G + Sbjct: 247 GPNYTWQPASEIQHLAHFLIDECGVDIVHGHSAHHVQ-----GVEVHKGKPIIYGCGDFVDDYAVDRRFRNDLGGV 317
BLAST of mRNA_P-wetherbeei_contig12184.1.1 vs. uniprot
Match: A0A0L0HJ51_SPIPD (PGA_cap domain-containing protein n=2 Tax=Spizellomyces TaxID=4815 RepID=A0A0L0HJ51_SPIPD) HSP 1 Score: 100 bits (250), Expect = 1.290e-23 Identity = 45/71 (63.38%), Postives = 53/71 (74.65%), Query Frame = 1 Query: 1 GPNYAWQPSPAIRSLARILIDGGVDVIHGHSSHHIQACRLQGVEIYKGKPIFYGLGDFVDDYAVDYSYRND 213 GPNY W+P + + AR LID GVD+IHGHS+HHIQ GVE+YKG+PI Y GDF+DDYAVD YRND Sbjct: 234 GPNYQWRPMASFKLFARWLIDHGVDIIHGHSAHHIQ-----GVEVYKGRPILYSAGDFLDDYAVDKHYRND 299
BLAST of mRNA_P-wetherbeei_contig12184.1.1 vs. uniprot
Match: A0A0D2AU04_9PEZI (PGA_cap domain-containing protein n=1 Tax=Verruconis gallopava TaxID=253628 RepID=A0A0D2AU04_9PEZI) HSP 1 Score: 100 bits (249), Expect = 1.590e-23 Identity = 49/76 (64.47%), Postives = 56/76 (73.68%), Query Frame = 1 Query: 1 GPNYAWQPSPAIRSLARILIDG-GVDVIHGHSSHHIQACRLQGVEIYKGKPIFYGLGDFVDDYAVDYSYRNDHGMI 225 GPNY+W PS IRSLA LID VD+IHGHSSHHIQ GVE+YKGK I YG GDFVDDYA++ +YRND + Sbjct: 231 GPNYSWHPSDDIRSLAHFLIDECEVDIIHGHSSHHIQ-----GVELYKGKLIIYGCGDFVDDYALNATYRNDRSAV 301
BLAST of mRNA_P-wetherbeei_contig12184.1.1 vs. uniprot
Match: A0A101MLK5_9EURO (PGA_cap domain-containing protein n=14 Tax=Penicillium TaxID=5073 RepID=A0A101MLK5_9EURO) HSP 1 Score: 100 bits (249), Expect = 1.630e-23 Identity = 48/76 (63.16%), Postives = 55/76 (72.37%), Query Frame = 1 Query: 1 GPNYAWQPSPAIRSLARILIDG-GVDVIHGHSSHHIQACRLQGVEIYKGKPIFYGLGDFVDDYAVDYSYRNDHGMI 225 GPNYAWQP I SLA LID GVD++HGHSSHHIQ GVE+Y GK + YG GDFVDDYA++ YRND G + Sbjct: 231 GPNYAWQPDGRITSLAHFLIDECGVDIVHGHSSHHIQ-----GVEVYHGKLVIYGCGDFVDDYALNEEYRNDLGAL 301
BLAST of mRNA_P-wetherbeei_contig12184.1.1 vs. uniprot
Match: A0A2J5HHR9_9EURO (PGA_cap domain-containing protein n=1 Tax=Aspergillus taichungensis TaxID=482145 RepID=A0A2J5HHR9_9EURO) HSP 1 Score: 100 bits (249), Expect = 1.810e-23 Identity = 46/76 (60.53%), Postives = 56/76 (73.68%), Query Frame = 1 Query: 1 GPNYAWQPSPAIRSLARILIDG-GVDVIHGHSSHHIQACRLQGVEIYKGKPIFYGLGDFVDDYAVDYSYRNDHGMI 225 GPNY WQP+ I+ LA LID GVD++HGHS+HH+Q GVE++ GKPI YG GDFVDDYAVD +RND G + Sbjct: 246 GPNYTWQPAAEIQHLAHFLIDECGVDIVHGHSAHHVQ-----GVEVHNGKPIIYGCGDFVDDYAVDRRFRNDLGGV 316
BLAST of mRNA_P-wetherbeei_contig12184.1.1 vs. uniprot
Match: A0A2T2NE50_CORCC (PGA_cap domain-containing protein n=1 Tax=Corynespora cassiicola Philippines TaxID=1448308 RepID=A0A2T2NE50_CORCC) HSP 1 Score: 97.8 bits (242), Expect = 3.210e-23 Identity = 46/72 (63.89%), Postives = 53/72 (73.61%), Query Frame = 1 Query: 1 GPNYAWQPSPAIRSLARILIDG-GVDVIHGHSSHHIQACRLQGVEIYKGKPIFYGLGDFVDDYAVDYSYRND 213 GPNY+W PS IRSLA L+D VD++HGHSSHH+Q GVE+YKGK I YG GDFVDDYA+ YRND Sbjct: 183 GPNYSWAPSDDIRSLAHFLVDECAVDIVHGHSSHHVQ-----GVEVYKGKLIIYGCGDFVDDYALHAEYRND 249
BLAST of mRNA_P-wetherbeei_contig12184.1.1 vs. uniprot
Match: A0A6A6J4K5_9PLEO (Putative polyglutamate biosynthesis protein n=1 Tax=Trematosphaeria pertusa TaxID=390896 RepID=A0A6A6J4K5_9PLEO) HSP 1 Score: 99.4 bits (246), Expect = 3.980e-23 Identity = 49/76 (64.47%), Postives = 56/76 (73.68%), Query Frame = 1 Query: 1 GPNYAWQPSPAIRSLARILIDG-GVDVIHGHSSHHIQACRLQGVEIYKGKPIFYGLGDFVDDYAVDYSYRNDHGMI 225 GPNYAW P+ I+SLA LID GVD+IHGHSSHHIQ GVE+YKG+ I YG GDFVDDYAV+ +RND I Sbjct: 218 GPNYAWMPAQEIQSLAHFLIDECGVDMIHGHSSHHIQ-----GVEVYKGRLIIYGCGDFVDDYAVNAKFRNDLSAI 288
BLAST of mRNA_P-wetherbeei_contig12184.1.1 vs. uniprot
Match: A0A1B8BVN9_9PEZI (PGA_cap domain-containing protein n=1 Tax=Pseudogymnoascus sp. WSF 3629 TaxID=1622147 RepID=A0A1B8BVN9_9PEZI) HSP 1 Score: 99.0 bits (245), Expect = 4.250e-23 Identity = 48/72 (66.67%), Postives = 53/72 (73.61%), Query Frame = 1 Query: 1 GPNYAWQPSPAIRSLARILIDG-GVDVIHGHSSHHIQACRLQGVEIYKGKPIFYGLGDFVDDYAVDYSYRND 213 GPNYAWQP+ IR +A LID GVD+IHGHSSHH+Q GVE YKGK I YG GDFVDDYAV YRN+ Sbjct: 225 GPNYAWQPAAEIRDMAHFLIDECGVDIIHGHSSHHVQ-----GVETYKGKLIIYGCGDFVDDYAVSPGYRNN 291 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12184.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig12184.1.1 >prot_P-wetherbeei_contig12184.1.1 ID=prot_P-wetherbeei_contig12184.1.1|Name=mRNA_P-wetherbeei_contig12184.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=75bp GPNYAWQPSPAIRSLARILIDGGVDVIHGHSSHHIQACRLQGVEIYKGKPback to top mRNA from alignment at P-wetherbeei_contig12184:578..918+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig12184.1.1 ID=mRNA_P-wetherbeei_contig12184.1.1|Name=mRNA_P-wetherbeei_contig12184.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=341bp|location=Sequence derived from alignment at P-wetherbeei_contig12184:578..918+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig12184:578..918+ >mRNA_P-wetherbeei_contig12184.1.1 ID=mRNA_P-wetherbeei_contig12184.1.1|Name=mRNA_P-wetherbeei_contig12184.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=225bp|location=Sequence derived from alignment at P-wetherbeei_contig12184:578..918+ (Phaeothamnion wetherbeei SAG_119_79)back to top |