mRNA_P-wetherbeei_contig1213.3.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1213.3.1 vs. uniprot
Match: A0A1E4FK63_9BACT (HTH cro/C1-type domain-containing protein n=1 Tax=bacterium SCN 62-11 TaxID=1660156 RepID=A0A1E4FK63_9BACT) HSP 1 Score: 57.0 bits (136), Expect = 1.190e-8 Identity = 31/75 (41.33%), Postives = 47/75 (62.67%), Query Frame = 1 Query: 1 KPKSDKPFLPLQMRKARRLAGLSQNELADKMDIHRNTIIRWESRVSEPSELQAEVLAQALNQPLEFFYSEPEPPA 225 +P+ F ++R+ARR G SQ ELA+ + +HR T+IRWES +S P+ Q E LA+A+ + E+F E P+ Sbjct: 3 RPRRQSDFQGGRLRQARRELGWSQAELAETLQVHRGTLIRWESNLSAPAPEQEEQLARAMGRTREWFQGEEPTPS 77
BLAST of mRNA_P-wetherbeei_contig1213.3.1 vs. uniprot
Match: A0A3D5T9G4_9FIRM (XRE family transcriptional regulator n=1 Tax=Lachnospiraceae bacterium TaxID=1898203 RepID=A0A3D5T9G4_9FIRM) HSP 1 Score: 48.9 bits (115), Expect = 5.520e-6 Identity = 22/60 (36.67%), Postives = 39/60 (65.00%), Query Frame = 1 Query: 25 LPLQMRKARRLAGLSQNELADKMDIHRNTIIRWESRVSEPSELQAEVLAQALNQPLEFFY 204 L + + AR AG++Q+++A KM + +NTI++WE SEPS Q +L+ + PL++ + Sbjct: 4 LQISLAAARVNAGMTQDDVAKKMKVSKNTIVKWEKGTSEPSVSQGRMLSDMYSMPLDYIF 63 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1213.3.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1213.3.1 >prot_P-wetherbeei_contig1213.3.1 ID=prot_P-wetherbeei_contig1213.3.1|Name=mRNA_P-wetherbeei_contig1213.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=75bp KPKSDKPFLPLQMRKARRLAGLSQNELADKMDIHRNTIIRWESRVSEPSEback to top mRNA from alignment at P-wetherbeei_contig1213:3312..3536- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1213.3.1 ID=mRNA_P-wetherbeei_contig1213.3.1|Name=mRNA_P-wetherbeei_contig1213.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=225bp|location=Sequence derived from alignment at P-wetherbeei_contig1213:3312..3536- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1213:3312..3536- >mRNA_P-wetherbeei_contig1213.3.1 ID=mRNA_P-wetherbeei_contig1213.3.1|Name=mRNA_P-wetherbeei_contig1213.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=225bp|location=Sequence derived from alignment at P-wetherbeei_contig1213:3312..3536- (Phaeothamnion wetherbeei SAG_119_79)back to top |