mRNA_P-wetherbeei_contig1212.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1212.2.1 vs. uniprot
Match: D7FVT2_ECTSI (RNase_PH domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FVT2_ECTSI) HSP 1 Score: 84.7 bits (208), Expect = 1.670e-18 Identity = 43/64 (67.19%), Postives = 51/64 (79.69%), Query Frame = 1 Query: 25 RSDGRRGNLLRSLYAEQKALHRADGSARFVQGNTSVLVAVYGPAPSKVARRERPDRATVDVTWR 216 R DGRR N +R L AEQ L+RADGSARFVQGNTSVL AVYGPAP+K R ER + AT+DV+++ Sbjct: 5 RRDGRRANQIRPLAAEQGILNRADGSARFVQGNTSVLAAVYGPAPAKSLRMERSEGATLDVSFK 68
BLAST of mRNA_P-wetherbeei_contig1212.2.1 vs. uniprot
Match: A0A835ZF16_9STRA (Ribosomal protein S5 domain 2-type protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZF16_9STRA) HSP 1 Score: 82.0 bits (201), Expect = 2.300e-17 Identity = 39/65 (60.00%), Postives = 50/65 (76.92%), Query Frame = 1 Query: 22 LRSDGRRGNLLRSLYAEQKALHRADGSARFVQGNTSVLVAVYGPAPSKVARRERPDRATVDVTWR 216 LR DGR G+ +R L+A+Q L+RADGS RF GNTSVLVAVYGPA ++E+PDRA ++V+WR Sbjct: 5 LRFDGRTGDQIRGLFADQGILNRADGSVRFGAGNTSVLVAVYGPAQPAQQKKEKPDRAIIEVSWR 69
BLAST of mRNA_P-wetherbeei_contig1212.2.1 vs. uniprot
Match: F0W748_9STRA (Uncharacterized protein AlNc14C28G2677 n=1 Tax=Albugo laibachii Nc14 TaxID=890382 RepID=F0W748_9STRA) HSP 1 Score: 71.2 bits (173), Expect = 3.140e-13 Identity = 36/65 (55.38%), Postives = 45/65 (69.23%), Query Frame = 1 Query: 22 LRSDGRRGNLLRSLYAEQKALHRADGSARFVQGNTSVLVAVYGPAPSKVARRERPDRATVDVTWR 216 LR DGR N LR + +EQ LHRADGS+ G+T+VLVAVYGP +K+AR E D+A +DV R Sbjct: 5 LRDDGRNCNELRQISSEQGTLHRADGSSNLTFGDTTVLVAVYGPGQAKIARNELVDKAAIDVCVR 69
BLAST of mRNA_P-wetherbeei_contig1212.2.1 vs. uniprot
Match: A0A8K1FJB6_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1FJB6_PYTOL) HSP 1 Score: 69.3 bits (168), Expect = 9.100e-13 Identity = 36/64 (56.25%), Postives = 43/64 (67.19%), Query Frame = 1 Query: 25 RSDGRRGNLLRSLYAEQKALHRADGSARFVQGNTSVLVAVYGPAPSKVARRERPDRATVDVTWR 216 R DGR GN LR +Q AL RADGSAR GN++VLVAVYGP K R E+ DR T+DV ++ Sbjct: 8 RHDGRAGNELRPFACDQGALFRADGSARMSHGNSTVLVAVYGPGQPKSRRNEQVDRVTLDVCFK 71
BLAST of mRNA_P-wetherbeei_contig1212.2.1 vs. uniprot
Match: A0A7S2VZA9_9STRA (Hypothetical protein n=1 Tax=Eucampia antarctica TaxID=49252 RepID=A0A7S2VZA9_9STRA) HSP 1 Score: 67.0 bits (162), Expect = 1.520e-11 Identity = 35/65 (53.85%), Postives = 43/65 (66.15%), Query Frame = 1 Query: 25 RSDGRRGN-LLRSLYAEQKALHRADGSARFVQGNTSVLVAVYGPAPSKVARRERPDRATVDVTWR 216 R DGR G LR L AE L RADGSA+F G+T+VL AVYGP +++ RE PDRA + V W+ Sbjct: 11 RPDGRDGGGKLRPLSAELSTLTRADGSAKFCAGSTTVLAAVYGPVAPRMSNRELPDRAMISVVWK 75
BLAST of mRNA_P-wetherbeei_contig1212.2.1 vs. uniprot
Match: A0A024GCT1_9STRA (RNase_PH domain-containing protein n=1 Tax=Albugo candida TaxID=65357 RepID=A0A024GCT1_9STRA) HSP 1 Score: 67.0 bits (162), Expect = 2.650e-11 Identity = 34/62 (54.84%), Postives = 43/62 (69.35%), Query Frame = 1 Query: 22 LRSDGRRGNLLRSLYAEQKALHRADGSARFVQGNTSVLVAVYGPAPSKVARRERPDRATVDV 207 LR DGR N LR + +EQ L+RADGS+ G+TSVLVAVYGP +K+ R E D+A +DV Sbjct: 2 LRDDGRNCNELRQIASEQGTLNRADGSSNLSIGDTSVLVAVYGPGQAKIVRNELVDKAAIDV 63
BLAST of mRNA_P-wetherbeei_contig1212.2.1 vs. uniprot
Match: A0A024TBK6_9STRA (Uncharacterized protein n=2 Tax=Aphanomyces TaxID=100860 RepID=A0A024TBK6_9STRA) HSP 1 Score: 65.5 bits (158), Expect = 3.590e-11 Identity = 34/64 (53.12%), Postives = 44/64 (68.75%), Query Frame = 1 Query: 25 RSDGRRGNLLRSLYAEQKALHRADGSARFVQGNTSVLVAVYGPAPSKVARRERPDRATVDVTWR 216 R DGR +R L EQ L+RADGSARF G+TSVL +V GPA +K+ R E+ D ATV+V ++ Sbjct: 10 RDDGRLVQEIRPLSCEQGLLNRADGSARFCHGSTSVLASVNGPAAAKIRRHEKVDAATVEVVFK 73
BLAST of mRNA_P-wetherbeei_contig1212.2.1 vs. uniprot
Match: A0A1E5W445_9POAL (Exosome complex exonuclease RRP46-like protein n=3 Tax=Panicoideae TaxID=147369 RepID=A0A1E5W445_9POAL) HSP 1 Score: 62.8 bits (151), Expect = 5.910e-11 Identity = 31/64 (48.44%), Postives = 41/64 (64.06%), Query Frame = 1 Query: 25 RSDGRRGNLLRSLYAEQKALHRADGSARFVQGNTSVLVAVYGPAPSKVARRERPDRATVDVTWR 216 R+DGR N LR LHRA GSAR+ QG+T VL AVYGP P + E P++A+++V W+ Sbjct: 6 RADGRNPNQLRPFSCTGNPLHRAHGSARWAQGDTVVLAAVYGPKPG-TRKGENPEKASIEVVWK 68
BLAST of mRNA_P-wetherbeei_contig1212.2.1 vs. uniprot
Match: A0A1V9ZVY3_9STRA (U4/U6 small nuclear ribonucleoprotein Prp4 n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1V9ZVY3_9STRA) HSP 1 Score: 65.9 bits (159), Expect = 6.990e-11 Identity = 33/64 (51.56%), Postives = 45/64 (70.31%), Query Frame = 1 Query: 25 RSDGRRGNLLRSLYAEQKALHRADGSARFVQGNTSVLVAVYGPAPSKVARRERPDRATVDVTWR 216 R DGR +R L EQ L+RADGSARF G TSV+ +V GPAP+K+ R+E ++AT+DV ++ Sbjct: 504 REDGRSVQEIRPLACEQGLLNRADGSARFNHGTTSVMASVSGPAPAKIRRQENVNQATLDVVFK 567
BLAST of mRNA_P-wetherbeei_contig1212.2.1 vs. uniprot
Match: A0A485KL27_9STRA (Aste57867_8748 protein n=1 Tax=Aphanomyces stellatus TaxID=120398 RepID=A0A485KL27_9STRA) HSP 1 Score: 64.3 bits (155), Expect = 9.550e-11 Identity = 33/64 (51.56%), Postives = 44/64 (68.75%), Query Frame = 1 Query: 25 RSDGRRGNLLRSLYAEQKALHRADGSARFVQGNTSVLVAVYGPAPSKVARRERPDRATVDVTWR 216 R DGR +R L EQ L+RADGSARF G TSVL +V GPA +K+ R+E+ D AT++V ++ Sbjct: 8 RGDGRLVQEIRPLSCEQGLLNRADGSARFSHGTTSVLASVNGPAAAKIRRQEKVDEATLEVVFK 71 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1212.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1212.2.1 >prot_P-wetherbeei_contig1212.2.1 ID=prot_P-wetherbeei_contig1212.2.1|Name=mRNA_P-wetherbeei_contig1212.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=72bp MQGALSGLRSDGRRGNLLRSLYAEQKALHRADGSARFVQGNTSVLVAVYGback to top mRNA from alignment at P-wetherbeei_contig1212:7399..7614+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1212.2.1 ID=mRNA_P-wetherbeei_contig1212.2.1|Name=mRNA_P-wetherbeei_contig1212.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=216bp|location=Sequence derived from alignment at P-wetherbeei_contig1212:7399..7614+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1212:7399..7614+ >mRNA_P-wetherbeei_contig1212.2.1 ID=mRNA_P-wetherbeei_contig1212.2.1|Name=mRNA_P-wetherbeei_contig1212.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=216bp|location=Sequence derived from alignment at P-wetherbeei_contig1212:7399..7614+ (Phaeothamnion wetherbeei SAG_119_79)back to top |