prot_P-wetherbeei_contig11900.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11900.2.1 vs. uniprot
Match: A0A5C9EWY6_9ARCH (Uncharacterized protein n=1 Tax=Candidatus Lokiarchaeota archaeon TaxID=2053489 RepID=A0A5C9EWY6_9ARCH) HSP 1 Score: 77.0 bits (188), Expect = 2.920e-16 Identity = 47/100 (47.00%), Postives = 59/100 (59.00%), Query Frame = 0 Query: 1 MAQITDAEAIRFANEVLRPLCEEARALAARCVALSTVWFGGINATF-AGATDTLEDGRAAQGVSRLTGADVTNAVAQLLGIDLN------AEIIQKPCVR 93 M IT+ +AI+F NE +RPL E+ RAL A A W GGI T + A D++ DGR A+G+SRLT ADV N V QL A++I KPCVR Sbjct: 1 MPDITNTQAIKFCNEQIRPLSEKFRALKAEVDATLVDWNGGIGTTIGSSADDSIADGREAEGISRLTAADVANLVTQLQAYQTQLDQAGVADVINKPCVR 100 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11900.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig11900.2.1 ID=prot_P-wetherbeei_contig11900.2.1|Name=mRNA_P-wetherbeei_contig11900.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=100bpback to top |