prot_P-wetherbeei_contig1177.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1177.2.1 vs. uniprot
Match: A0A6H5KGP0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KGP0_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 3.660e-14 Identity = 36/55 (65.45%), Postives = 44/55 (80.00%), Query Frame = 0 Query: 2 KRVRTENTRFKQLAEEFMNVEGEATIDEDLMRELREMKEKMAGPGDKYANDTRKY 56 KRV+ E+ +F +EFMNV+GEA D D+M+ELR+MKEKMAGPGDKYA DTR Y Sbjct: 339 KRVKVESAKFDAEKDEFMNVDGEAEFDVDIMKELRDMKEKMAGPGDKYAKDTRAY 393
BLAST of mRNA_P-wetherbeei_contig1177.2.1 vs. uniprot
Match: A0A835YR84_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YR84_9STRA) HSP 1 Score: 70.5 bits (171), Expect = 2.460e-13 Identity = 37/55 (67.27%), Postives = 44/55 (80.00%), Query Frame = 0 Query: 2 KRVRTENTRFKQLAEEFMNVEGEATIDEDLMRELREMKEKMAGPGDKYANDTRKY 56 KR+R ENT+F+Q AEE M VEGE +EDLMRELR MKE+ GPGDKYA +TR+Y Sbjct: 102 KRIREENTKFQQNAEEHM-VEGEVAYNEDLMRELRRMKEENVGPGDKYAKETRRY 155
BLAST of mRNA_P-wetherbeei_contig1177.2.1 vs. uniprot
Match: D8LDI5_ECTSI (MscS Mechanosensitive ion channel n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDI5_ECTSI) HSP 1 Score: 70.5 bits (171), Expect = 6.440e-13 Identity = 34/55 (61.82%), Postives = 43/55 (78.18%), Query Frame = 0 Query: 2 KRVRTENTRFKQLAEEFMNVEGEATIDEDLMRELREMKEKMAGPGDKYANDTRKY 56 KRV+ E+ +F +EFM+V+GEA D D+M+ELR+MKEKMAGPGD YA DTR Y Sbjct: 172 KRVKVESAKFDAEKDEFMDVDGEAEFDVDIMKELRDMKEKMAGPGDSYAKDTRAY 226 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1177.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig1177.2.1 ID=prot_P-wetherbeei_contig1177.2.1|Name=mRNA_P-wetherbeei_contig1177.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=56bpback to top |