prot_P-wetherbeei_contig1171.2.3 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1171.2.3 vs. uniprot
Match: A0A7S2SVU6_9STRA (Hypothetical protein (Fragment) n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2SVU6_9STRA) HSP 1 Score: 65.9 bits (159), Expect = 4.700e-8 Identity = 31/67 (46.27%), Postives = 46/67 (68.66%), Query Frame = 0 Query: 989 TVVLACPQPMVGFVIGKRGATIKLVMARSGAHVELDQSGPREADKKVLIHGPPAAVEDAKRLVNDIL 1055 +V++ CPQ MVG +IGK G TI+ + RSG V+++Q+ P ++V I G P A E A+RL+N+IL Sbjct: 153 SVIVECPQNMVGRIIGKGGETIRDIQTRSGCSVQINQNFPEGLPRQVTISGTPQATEVARRLINNIL 219
BLAST of mRNA_P-wetherbeei_contig1171.2.3 vs. uniprot
Match: A0A7S2UTA3_9STRA (Hypothetical protein n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2UTA3_9STRA) HSP 1 Score: 59.7 bits (143), Expect = 2.500e-5 Identity = 33/75 (44.00%), Postives = 48/75 (64.00%), Query Frame = 0 Query: 981 GEHTGGTVTVVLACPQPMVGFVIGKRGATIKLVMARSGAHVELDQSG-PREADKKVLIHGPPAAVEDAKRLVNDI 1054 GE G +T ++ CP MVG VIG+ G TI+ + RSGA +++DQSG P E KKV+I G ++ A +LV+ + Sbjct: 205 GEKGPGWITHLIDCPPQMVGRVIGRGGETIRELQQRSGARIQVDQSGAPNE--KKVVIQGTQQTIDAAIKLVDQV 277
BLAST of mRNA_P-wetherbeei_contig1171.2.3 vs. uniprot
Match: A0A139AY07_GONPJ (Uncharacterized protein n=1 Tax=Gonapodya prolifera (strain JEL478) TaxID=1344416 RepID=A0A139AY07_GONPJ) HSP 1 Score: 58.5 bits (140), Expect = 5.180e-5 Identity = 32/81 (39.51%), Postives = 48/81 (59.26%), Query Frame = 0 Query: 980 RGEHTG-GTVTVVLACPQPMVGFVIGKRGATIKLVMARSGAHVEL---DQSGPREADKKVLIHGPPAAVEDAKRLVNDILA 1056 RG G G + +A P+ VG VIG+ G T++ + SG + + QS P D+ V I GPP AVE+AKRL+++I++ Sbjct: 244 RGPPMGMGDTSTTVAIPKSTVGLVIGRSGETVQRLSRESGTRINVTPDSQSDPNSNDRIVTIVGPPQAVEEAKRLIDEIVS 324 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1171.2.3 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig1171.2.3 ID=prot_P-wetherbeei_contig1171.2.3|Name=mRNA_P-wetherbeei_contig1171.2.3|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=1056bpback to top |