mRNA_P-wetherbeei_contig117.3.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig117.3.1 vs. uniprot
Match: A0A7S2P0C2_9STRA (Hypothetical protein (Fragment) n=1 Tax=Leptocylindrus danicus TaxID=163516 RepID=A0A7S2P0C2_9STRA) HSP 1 Score: 103 bits (258), Expect = 2.540e-21 Identity = 37/61 (60.66%), Postives = 47/61 (77.05%), Query Frame = 2 Query: 2267 PSVCTYANSGGAYLEQHWYNCYSCGLIGERGCCRLCVRVCHRDHDVNYSRYSAFLCDCGVD 2449 P CTY +GG + EQHWYNCY+CGL+ ++GCC LC +VCH+ HDV YSR S+F CDCG + Sbjct: 24 PRTCTYVETGGDFTEQHWYNCYTCGLVKDKGCCSLCAQVCHKGHDVGYSRRSSFFCDCGAE 84
BLAST of mRNA_P-wetherbeei_contig117.3.1 vs. uniprot
Match: A0A835Z9Y3_9STRA (E3 ubiquitin-protein ligase UBR4-domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z9Y3_9STRA) HSP 1 Score: 104 bits (260), Expect = 9.610e-19 Identity = 40/76 (52.63%), Postives = 56/76 (73.68%), Query Frame = 2 Query: 2267 PSVCTYANSGGAYLEQHWYNCYSCGLIGERGCCRLCVRVCHRDHDVNYSRYSAFLCDCGVDAAGGDASGGSAPSTP 2494 P CT+ ++ G Y++QHWYNC++CGL+ E+GCC+LC RVCH+ H+++YSRYS F CDCG G D + S P +P Sbjct: 1873 PLSCTFMDTDGDYIQQHWYNCHTCGLVNEKGCCKLCTRVCHKGHELSYSRYSPFSCDCG----GKDHNASSEPDSP 1944
BLAST of mRNA_P-wetherbeei_contig117.3.1 vs. uniprot
Match: A0A7S4IXK0_9STRA (Hypothetical protein (Fragment) n=1 Tax=Odontella aurita TaxID=265563 RepID=A0A7S4IXK0_9STRA) HSP 1 Score: 103 bits (257), Expect = 1.450e-18 Identity = 39/66 (59.09%), Postives = 49/66 (74.24%), Query Frame = 2 Query: 2258 ERTPSVCTYANSGGAYLEQHWYNCYSCGLIGERGCCRLCVRVCHRDHDVNYSRYSAFLCDCGVDAA 2455 +R CT+ +GG + EQHWYNCY+CGL+ ++GCC LCV VCHR HDV YSR S+F CDCG + A Sbjct: 837 DRVRRTCTFIETGGDFKEQHWYNCYTCGLLWDKGCCSLCVLVCHRGHDVGYSRKSSFFCDCGAEVA 902
BLAST of mRNA_P-wetherbeei_contig117.3.1 vs. uniprot
Match: A0A7S2UH47_9STRA (Hypothetical protein (Fragment) n=1 Tax=Attheya septentrionalis TaxID=420275 RepID=A0A7S2UH47_9STRA) HSP 1 Score: 103 bits (257), Expect = 1.880e-18 Identity = 37/61 (60.66%), Postives = 47/61 (77.05%), Query Frame = 2 Query: 2273 VCTYANSGGAYLEQHWYNCYSCGLIGERGCCRLCVRVCHRDHDVNYSRYSAFLCDCGVDAA 2455 CT+ +GG + EQHWYNCYSC L+ ERGCC +C +VCH+ HDV YSR+S+F CDCG + A Sbjct: 3 TCTFVETGGEFFEQHWYNCYSCSLLWERGCCSICAQVCHKGHDVGYSRFSSFFCDCGAEHA 63
BLAST of mRNA_P-wetherbeei_contig117.3.1 vs. uniprot
Match: A0A7S3Q419_9STRA (Hypothetical protein n=1 Tax=Chaetoceros debilis TaxID=122233 RepID=A0A7S3Q419_9STRA) HSP 1 Score: 100 bits (249), Expect = 1.740e-17 Identity = 37/66 (56.06%), Postives = 49/66 (74.24%), Query Frame = 2 Query: 2252 GLERTPSVCTYANSGGAYLEQHWYNCYSCGLIGERGCCRLCVRVCHRDHDVNYSRYSAFLCDCGVD 2449 G +R + C++ +GG + EQHWYNCY+CGL ++GCC LC RVCH+ HDV YSR S+F CDCG + Sbjct: 677 GKKRHQTTCSFKFTGGEFTEQHWYNCYTCGLTWDKGCCSLCARVCHKGHDVGYSRKSSFFCDCGAE 742
BLAST of mRNA_P-wetherbeei_contig117.3.1 vs. uniprot
Match: D8LLX0_ECTSI (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LLX0_ECTSI) HSP 1 Score: 99.8 bits (247), Expect = 3.210e-17 Identity = 37/65 (56.92%), Postives = 48/65 (73.85%), Query Frame = 2 Query: 2267 PSVCTYANSGGAYLEQHWYNCYSCGLIGERGCCRLCVRVCHRDHDVNYSRYSAFLCDCGVDAAGG 2461 P VCT+ +S ++ QHWY+CY+C L+ ++GCCRLC RVCHR HDV+Y+R S F CDCG A G Sbjct: 1860 PLVCTFVSSHKQFVNQHWYHCYTCNLVNDKGCCRLCARVCHRGHDVSYARLSCFFCDCGSSTAEG 1924
BLAST of mRNA_P-wetherbeei_contig117.3.1 vs. uniprot
Match: L1IUA6_GUITC (Uncharacterized protein n=5 Tax=Guillardia theta TaxID=55529 RepID=L1IUA6_GUITC) HSP 1 Score: 98.2 bits (243), Expect = 9.260e-17 Identity = 37/71 (52.11%), Postives = 46/71 (64.79%), Query Frame = 2 Query: 2273 VCTYANSGGAYLEQHWYNCYSCGLIGERGCCRLCVRVCHRDHDVNYSRYSAFLCDCGVDAAGGDASGGSAP 2485 VCTY + + EQHWY+C++CGL+ + GCC +C +VCHR HDV YSRYS F CDCG G AP Sbjct: 1580 VCTYIKTSNTFSEQHWYHCWTCGLVFQEGCCAVCAKVCHRGHDVTYSRYSRFFCDCGAGKRAGHTCSALAP 1650
BLAST of mRNA_P-wetherbeei_contig117.3.1 vs. uniprot
Match: F0Y2R4_AURAN (UBR-type domain-containing protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0Y2R4_AURAN) HSP 1 Score: 98.2 bits (243), Expect = 9.500e-17 Identity = 36/63 (57.14%), Postives = 47/63 (74.60%), Query Frame = 2 Query: 2276 CTYANSGGAYLEQHWYNCYSCGLIGERGCCRLCVRVCHRDHDVNYSRYSAFLCDCGVDAAGGD 2464 CTYA SGG +++QHWYNC +CGL+G++GCC C R CH H+++YSR S+F CDCG G D Sbjct: 2071 CTYATSGGDFVDQHWYNCATCGLVGDKGCCSACARKCHAGHELSYSRKSSFFCDCGARGDGDD 2133
BLAST of mRNA_P-wetherbeei_contig117.3.1 vs. uniprot
Match: A0A1Z5JDE4_FISSO (E3 ubiquitin-protein ligase UBR4 n=1 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5JDE4_FISSO) HSP 1 Score: 97.8 bits (242), Expect = 1.190e-16 Identity = 41/73 (56.16%), Postives = 52/73 (71.23%), Query Frame = 2 Query: 2255 LERTPSVCTYANSGGAYLEQHWYNCYSCGLIGERGCCRLCVRVCHRDHDVNYSRYSAFLCDCGVDA-AGGDAS 2470 L PSVCTY + + EQHWY C++CGL+G+RGCC LC VCHR HDV+Y+R S+F CDCG + + GD S Sbjct: 1809 LATLPSVCTYV-AFSDFQEQHWYQCFTCGLVGDRGCCSLCALVCHRGHDVSYARKSSFFCDCGAEQPSNGDTS 1880
BLAST of mRNA_P-wetherbeei_contig117.3.1 vs. uniprot
Match: A0A8J2S518_9STRA (Hypothetical protein n=2 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A8J2S518_9STRA) HSP 1 Score: 97.8 bits (242), Expect = 1.230e-16 Identity = 33/60 (55.00%), Postives = 48/60 (80.00%), Query Frame = 2 Query: 2267 PSVCTYANSGGAYLEQHWYNCYSCGLIGERGCCRLCVRVCHRDHDVNYSRYSAFLCDCGV 2446 P+ CT+A++ GA++EQHWYNC +CGL+G++G C C+R CH HD++Y+R S+F CDCG Sbjct: 1907 PTKCTFASTSGAFVEQHWYNCATCGLVGDKGACAACIRTCHAGHDISYARKSSFFCDCGA 1966 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig117.3.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig117.3.1 >prot_P-wetherbeei_contig117.3.1 ID=prot_P-wetherbeei_contig117.3.1|Name=mRNA_P-wetherbeei_contig117.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=1149bp MQELMADAAAPRPDGGAGGSGGGAGAAIKALCAAAVTEYARASASPACAEback to top mRNA from alignment at P-wetherbeei_contig117:3105..6579+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig117.3.1 ID=mRNA_P-wetherbeei_contig117.3.1|Name=mRNA_P-wetherbeei_contig117.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=3475bp|location=Sequence derived from alignment at P-wetherbeei_contig117:3105..6579+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig117:3105..6579+ >mRNA_P-wetherbeei_contig117.3.1 ID=mRNA_P-wetherbeei_contig117.3.1|Name=mRNA_P-wetherbeei_contig117.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=3447bp|location=Sequence derived from alignment at P-wetherbeei_contig117:3105..6579+ (Phaeothamnion wetherbeei SAG_119_79)back to top |