mRNA_P-wetherbeei_contig11649.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11649.1.1 vs. uniprot
Match: A0A0D2WVR6_CAPO3 (Fido domain-containing protein n=1 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2WVR6_CAPO3) HSP 1 Score: 69.3 bits (168), Expect = 5.010e-12 Identity = 30/53 (56.60%), Postives = 38/53 (71.70%), Query Frame = 1 Query: 127 QLAADLYFDTTTIHPFQDGNGHLFRLLVSYAFMCCDTPSPVILTNGHSRAAKH 285 +LAA L+ T+HPF++GNG L RLL SY F C P PV++T+GHSRA KH Sbjct: 181 RLAAWLFVQVITLHPFENGNGRLCRLLASYVFQKCGVPFPVVITSGHSRAYKH 233
BLAST of mRNA_P-wetherbeei_contig11649.1.1 vs. uniprot
Match: A0A836B787_9CHLO (Fido domain-containing protein n=1 Tax=Chlamydomonas schloesseri TaxID=2026947 RepID=A0A836B787_9CHLO) HSP 1 Score: 67.0 bits (162), Expect = 9.250e-12 Identity = 39/104 (37.50%), Postives = 57/104 (54.81%), Query Frame = 1 Query: 13 VSAGCYWTTKVYAGT-----HYRLLEGGGHAAFND--------ARGSIHLLQLAADLYFDTTTIHPFQDGNGHLFRLLVSYAFMCCDTPSPVILTNGHSRAAKH 285 VSAG Y T ++GT ++GG A + A G++ +AA L+++ +HPFQ+GNG L RLLV+YA M P PV L+NGH ++ +H Sbjct: 25 VSAGEYRTLPAHSGTGTVYPEAEYIDGGMVAVLENFHRDLALVASGALDKHIMAARLFYEMIMLHPFQNGNGRLCRLLVTYALMKAGDPFPVCLSNGHKKSRQH 128
BLAST of mRNA_P-wetherbeei_contig11649.1.1 vs. uniprot
Match: A0A150GV29_GONPE (Fido domain-containing protein n=1 Tax=Gonium pectorale TaxID=33097 RepID=A0A150GV29_GONPE) HSP 1 Score: 56.6 bits (135), Expect = 1.960e-7 Identity = 24/46 (52.17%), Postives = 31/46 (67.39%), Query Frame = 1 Query: 130 LAADLYFDTTTIHPFQDGNGHLFRLLVSYAFMCCDTPSPVILTNGH 267 LAA L++D T HPF++GNG L RLL ++A M P P LT+GH Sbjct: 150 LAAQLFYDMVTAHPFENGNGRLCRLLAAFALMAAGDPFPTPLTDGH 195
BLAST of mRNA_P-wetherbeei_contig11649.1.1 vs. uniprot
Match: A0A1X7V9F6_AMPQE (Fido domain-containing protein n=1 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7V9F6_AMPQE) HSP 1 Score: 55.5 bits (132), Expect = 6.500e-7 Identity = 23/52 (44.23%), Postives = 34/52 (65.38%), Query Frame = 1 Query: 130 LAADLYFDTTTIHPFQDGNGHLFRLLVSYAFMCCDTPSPVILTNGHSRAAKH 285 LA +Y+ ++HPF+DGNG + RLL Y+ M P P +LT+GH ++ KH Sbjct: 202 LATWVYYHVVSLHPFEDGNGRMSRLLWCYSLMKDGLPFPPLLTSGHKKSQKH 253
BLAST of mRNA_P-wetherbeei_contig11649.1.1 vs. uniprot
Match: UPI0019C555A6 (Fic family protein n=1 Tax=Rhizobacter sp. TaxID=1909292 RepID=UPI0019C555A6) HSP 1 Score: 52.4 bits (124), Expect = 9.140e-6 Identity = 26/58 (44.83%), Postives = 36/58 (62.07%), Query Frame = 1 Query: 85 HAAFNDARGSIHLLQLAADLYFDTTTIHPFQDGNGHLFRLLVSYAFMCCDTPSPVILT 258 H + +D SIHLL LAA +++ IHPF DGNG + R+L++ A M D P +I T Sbjct: 170 HKSLSDE--SIHLLLLAATFHYEFIRIHPFDDGNGRIARILMNLALMMKDFPPAIIKT 225
BLAST of mRNA_P-wetherbeei_contig11649.1.1 vs. uniprot
Match: UPI0018EB5920 (Fic family protein n=1 Tax=Chitinophaga sp. ASV3 TaxID=2795108 RepID=UPI0018EB5920) HSP 1 Score: 50.8 bits (120), Expect = 3.180e-5 Identity = 25/48 (52.08%), Postives = 32/48 (66.67%), Query Frame = 1 Query: 109 GSIHLLQLAADLYFDTTTIHPFQDGNGHLFRLLVSYAFMCCDTPSPVI 252 G +H LQLAA L++ IHPF DGNG L RLL++YA + + P VI Sbjct: 175 GELHPLQLAALLHYRFVRIHPFDDGNGRLSRLLMNYALLRNNYPPVVI 222
BLAST of mRNA_P-wetherbeei_contig11649.1.1 vs. uniprot
Match: UPI00141FF1D8 (Fic family protein n=1 Tax=Chitinophaga sp. Cy-1792 TaxID=2608339 RepID=UPI00141FF1D8) HSP 1 Score: 50.4 bits (119), Expect = 4.350e-5 Identity = 23/48 (47.92%), Postives = 31/48 (64.58%), Query Frame = 1 Query: 109 GSIHLLQLAADLYFDTTTIHPFQDGNGHLFRLLVSYAFMCCDTPSPVI 252 G +H LQLAA L++ IHPF DGNG L RLL++Y + + P +I Sbjct: 175 GELHPLQLAALLHYRFVRIHPFDDGNGRLSRLLMNYVLLRANYPPAII 222
BLAST of mRNA_P-wetherbeei_contig11649.1.1 vs. uniprot
Match: A0A327WA82_9BACT (Fic family protein n=1 Tax=Chitinophaga dinghuensis TaxID=1539050 RepID=A0A327WA82_9BACT) HSP 1 Score: 49.7 bits (117), Expect = 8.100e-5 Identity = 25/55 (45.45%), Postives = 36/55 (65.45%), Query Frame = 1 Query: 109 GSIHLLQLAADLYFDTTTIHPFQDGNGHLFRLLVSYAFMCCDTPSPVILTNGHSR 273 G +H +QLAA L++ IHPF DGNG L RLL++Y+ + + P PVI+ + R Sbjct: 175 GELHPIQLAALLHYRFVRIHPFDDGNGRLSRLLMNYSLLRNNYP-PVIIKSEDKR 228 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11649.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 8
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11649.1.1 >prot_P-wetherbeei_contig11649.1.1 ID=prot_P-wetherbeei_contig11649.1.1|Name=mRNA_P-wetherbeei_contig11649.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=95bp DGNLVSAGCYWTTKVYAGTHYRLLEGGGHAAFNDARGSIHLLQLAADLYFback to top mRNA from alignment at P-wetherbeei_contig11649:857..1141+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11649.1.1 ID=mRNA_P-wetherbeei_contig11649.1.1|Name=mRNA_P-wetherbeei_contig11649.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=285bp|location=Sequence derived from alignment at P-wetherbeei_contig11649:857..1141+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11649:857..1141+ >mRNA_P-wetherbeei_contig11649.1.1 ID=mRNA_P-wetherbeei_contig11649.1.1|Name=mRNA_P-wetherbeei_contig11649.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=285bp|location=Sequence derived from alignment at P-wetherbeei_contig11649:857..1141+ (Phaeothamnion wetherbeei SAG_119_79)back to top |