mRNA_P-wetherbeei_contig1164.3.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1164.3.1 vs. uniprot
Match: UPI002022A89E (FAD-binding oxidoreductase n=1 Tax=Natronobacterium sp. WLHS5 TaxID=2932267 RepID=UPI002022A89E) HSP 1 Score: 49.7 bits (117), Expect = 9.790e-5 Identity = 26/53 (49.06%), Postives = 36/53 (67.92%), Query Frame = 1 Query: 151 DDASVKALEETLRGKLILPFPESDEYDDARELWNLDITELRPAAIIQAQGASD 309 D+ ++ +E LRG LI FP+S+EY+DAR +WN I E PA I++ GASD Sbjct: 15 DENDLREFDEDLRGDLI--FPDSEEYEDARNVWNGLINEY-PAVIVRVNGASD 64 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1164.3.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1164.3.1 >prot_P-wetherbeei_contig1164.3.1 ID=prot_P-wetherbeei_contig1164.3.1|Name=mRNA_P-wetherbeei_contig1164.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=57bp MLTRDDASVKALEETLRGKLILPFPESDEYDDARELWNLDITELRPAAIIback to top mRNA from alignment at P-wetherbeei_contig1164:1507..2059+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1164.3.1 ID=mRNA_P-wetherbeei_contig1164.3.1|Name=mRNA_P-wetherbeei_contig1164.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=553bp|location=Sequence derived from alignment at P-wetherbeei_contig1164:1507..2059+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1164:1507..2059+ >mRNA_P-wetherbeei_contig1164.3.1 ID=mRNA_P-wetherbeei_contig1164.3.1|Name=mRNA_P-wetherbeei_contig1164.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=171bp|location=Sequence derived from alignment at P-wetherbeei_contig1164:1507..2059+ (Phaeothamnion wetherbeei SAG_119_79)back to top |