prot_P-wetherbeei_contig10117.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10117.1.1 vs. uniprot
Match: D7FLD8_ECTSI (Mitochondrial import inner membrane translocase TIM14 homolog n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FLD8_ECTSI) HSP 1 Score: 99.8 bits (247), Expect = 9.570e-25 Identity = 50/57 (87.72%), Postives = 55/57 (96.49%), Query Frame = 0 Query: 1 MTRREAALILGVRESATPQRIKEAHRRILMLNHPDKGGSKLMAAKINEAKEMLLKGR 57 MTR+EAALILGVRESAT QRIK++HRRILM+NHPDKGGSK MAAKINEAKE+LLKGR Sbjct: 152 MTRKEAALILGVRESATAQRIKDSHRRILMINHPDKGGSKYMAAKINEAKEILLKGR 208
BLAST of mRNA_P-wetherbeei_contig10117.1.1 vs. uniprot
Match: K8Z3F4_NANGC (Chaperone-domain containing protein n=1 Tax=Nannochloropsis gaditana (strain CCMP526) TaxID=1093141 RepID=K8Z3F4_NANGC) HSP 1 Score: 99.0 bits (245), Expect = 3.050e-24 Identity = 50/57 (87.72%), Postives = 54/57 (94.74%), Query Frame = 0 Query: 1 MTRREAALILGVRESATPQRIKEAHRRILMLNHPDKGGSKLMAAKINEAKEMLLKGR 57 MTRREAALILGVRESA+PQRIKEAHRRILMLNHPD GGS +A+KINEAKE+LLKGR Sbjct: 173 MTRREAALILGVRESASPQRIKEAHRRILMLNHPDTGGSTYLASKINEAKELLLKGR 229
BLAST of mRNA_P-wetherbeei_contig10117.1.1 vs. uniprot
Match: A0A835YPD5_9STRA (Mitochondrial import inner membrane translocase TIM14 n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YPD5_9STRA) HSP 1 Score: 95.9 bits (237), Expect = 5.730e-23 Identity = 48/57 (84.21%), Postives = 53/57 (92.98%), Query Frame = 0 Query: 1 MTRREAALILGVRESATPQRIKEAHRRILMLNHPDKGGSKLMAAKINEAKEMLLKGR 57 MTRREAALILGVRESA+PQRIK+AHRRILMLNHPD+GGS MA KIN AKE+LLKG+ Sbjct: 182 MTRREAALILGVRESASPQRIKDAHRRILMLNHPDRGGSTYMAGKINAAKEILLKGK 238
BLAST of mRNA_P-wetherbeei_contig10117.1.1 vs. uniprot
Match: A0A7S3K0B7_9STRA (Hypothetical protein n=1 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3K0B7_9STRA) HSP 1 Score: 90.1 bits (222), Expect = 1.170e-21 Identity = 44/57 (77.19%), Postives = 50/57 (87.72%), Query Frame = 0 Query: 1 MTRREAALILGVRESATPQRIKEAHRRILMLNHPDKGGSKLMAAKINEAKEMLLKGR 57 MTRREAALILGVRESA +RIKEAHRRIL +NHPD GGS +A K+NEAKE+L+KGR Sbjct: 85 MTRREAALILGVRESANSERIKEAHRRILRINHPDMGGSTFLAGKVNEAKELLMKGR 141
BLAST of mRNA_P-wetherbeei_contig10117.1.1 vs. uniprot
Match: A0A7S2JUU2_9STRA (Hypothetical protein n=1 Tax=Leptocylindrus danicus TaxID=163516 RepID=A0A7S2JUU2_9STRA) HSP 1 Score: 91.7 bits (226), Expect = 2.340e-21 Identity = 46/57 (80.70%), Postives = 53/57 (92.98%), Query Frame = 0 Query: 1 MTRREAALILGVRESATPQRIKEAHRRILMLNHPDKGGSKLMAAKINEAKEMLLKGR 57 MTRREAALILGVRESAT +RIK+AHR+IL+LNHPD GGS MA+KINEAKE+LLKG+ Sbjct: 179 MTRREAALILGVRESATVKRIKDAHRKILILNHPDTGGSTYMASKINEAKELLLKGK 235
BLAST of mRNA_P-wetherbeei_contig10117.1.1 vs. uniprot
Match: A0A6T7GEL2_9STRA (Hypothetical protein n=1 Tax=Attheya septentrionalis TaxID=420275 RepID=A0A6T7GEL2_9STRA) HSP 1 Score: 91.7 bits (226), Expect = 3.100e-21 Identity = 44/57 (77.19%), Postives = 52/57 (91.23%), Query Frame = 0 Query: 1 MTRREAALILGVRESATPQRIKEAHRRILMLNHPDKGGSKLMAAKINEAKEMLLKGR 57 MTRREAAL+LGVRES++P+RIKEAHR +LMLNHPD GGS +A KINEAKE+L+KGR Sbjct: 192 MTRREAALVLGVRESSSPKRIKEAHRNLLMLNHPDTGGSTYIAGKINEAKELLIKGR 248
BLAST of mRNA_P-wetherbeei_contig10117.1.1 vs. uniprot
Match: F0YBX3_AURAN (J domain-containing protein (Fragment) n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0YBX3_AURAN) HSP 1 Score: 86.7 bits (213), Expect = 3.180e-21 Identity = 42/54 (77.78%), Postives = 49/54 (90.74%), Query Frame = 0 Query: 1 MTRREAALILGVRESATPQRIKEAHRRILMLNHPDKGGSKLMAAKINEAKEMLL 54 MTRREAALILGVRESAT QRIK+AHRRIL +NHPD GGS ++AK+NEAKE+L+ Sbjct: 12 MTRREAALILGVRESATAQRIKDAHRRILRINHPDMGGSAFLSAKVNEAKELLI 65
BLAST of mRNA_P-wetherbeei_contig10117.1.1 vs. uniprot
Match: A0A7S2MIG4_9STRA (Hypothetical protein n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2MIG4_9STRA) HSP 1 Score: 90.1 bits (222), Expect = 6.560e-21 Identity = 45/57 (78.95%), Postives = 50/57 (87.72%), Query Frame = 0 Query: 1 MTRREAALILGVRESATPQRIKEAHRRILMLNHPDKGGSKLMAAKINEAKEMLLKGR 57 MTRREAA ILG RESA+ +RIKEAHRRILM NHPDKGGS +A KINEAKEML+KG+ Sbjct: 163 MTRREAAQILGTRESASTERIKEAHRRILMANHPDKGGSAFLATKINEAKEMLVKGK 219
BLAST of mRNA_P-wetherbeei_contig10117.1.1 vs. uniprot
Match: B8C3S0_THAPS (Dnaj-like protein (Fragment) n=1 Tax=Thalassiosira pseudonana TaxID=35128 RepID=B8C3S0_THAPS) HSP 1 Score: 86.7 bits (213), Expect = 7.140e-21 Identity = 42/54 (77.78%), Postives = 50/54 (92.59%), Query Frame = 0 Query: 1 MTRREAALILGVRESATPQRIKEAHRRILMLNHPDKGGSKLMAAKINEAKEMLL 54 MTR+EAALILGVRES+TP+RIKEAHR++L+LNHPD GGS +A KINEAKE+LL Sbjct: 42 MTRKEAALILGVRESSTPKRIKEAHRKLLILNHPDTGGSTYIAGKINEAKELLL 95
BLAST of mRNA_P-wetherbeei_contig10117.1.1 vs. uniprot
Match: A0A482S026_9ARCH (J domain-containing protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482S026_9ARCH) HSP 1 Score: 89.0 bits (219), Expect = 1.110e-20 Identity = 43/57 (75.44%), Postives = 52/57 (91.23%), Query Frame = 0 Query: 1 MTRREAALILGVRESATPQRIKEAHRRILMLNHPDKGGSKLMAAKINEAKEMLLKGR 57 MT+REAALILGVRESA +R+KEAHRR+L+LNHPDKGGS + AKINEAK++LLKG+ Sbjct: 138 MTKREAALILGVRESAAVERVKEAHRRMLILNHPDKGGSVFITAKINEAKDLLLKGK 194 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10117.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig10117.1.1 ID=prot_P-wetherbeei_contig10117.1.1|Name=mRNA_P-wetherbeei_contig10117.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=59bpback to top |