mRNA_P-wetherbeei_contig11532.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11532.1.1 vs. uniprot
Match: D7G1X1_ECTSI (DEAD box helicase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G1X1_ECTSI) HSP 1 Score: 51.6 bits (122), Expect = 1.140e-5 Identity = 35/77 (45.45%), Postives = 46/77 (59.74%), Query Frame = 2 Query: 14 LPEGLMLTHVRALHEDKDALCSLCCERQYIGRTLVFADSMAGARRRTVLLALLWLAVAALLHAQMQQWQRRCNLDLF 244 LP L L +++L +KD L C Y GRTL+F +++A ARR + LL L + A LHAQMQQ QR +LD F Sbjct: 507 LPSTLKLCSIKSLQMEKDVHAYLFCA-MYPGRTLIFVNAIAIARRLSALLCALSVP-ATPLHAQMQQRQRLKSLDRF 581
BLAST of mRNA_P-wetherbeei_contig11532.1.1 vs. uniprot
Match: A0A6H5KFI4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KFI4_9PHAE) HSP 1 Score: 51.2 bits (121), Expect = 1.570e-5 Identity = 35/77 (45.45%), Postives = 46/77 (59.74%), Query Frame = 2 Query: 14 LPEGLMLTHVRALHEDKDALCSLCCERQYIGRTLVFADSMAGARRRTVLLALLWLAVAALLHAQMQQWQRRCNLDLF 244 LP L L +++L +KD L C Y GRTL+F +++A ARR + LL L + A LHAQMQQ QR +LD F Sbjct: 672 LPSTLKLCSIKSLQMEKDVHAYLFCA-MYPGRTLIFVNAIAIARRLSALLCALNVP-ATPLHAQMQQRQRLKSLDRF 746 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11532.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11532.1.1 >prot_P-wetherbeei_contig11532.1.1 ID=prot_P-wetherbeei_contig11532.1.1|Name=mRNA_P-wetherbeei_contig11532.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=82bp MLTLPEGLMLTHVRALHEDKDALCSLCCERQYIGRTLVFADSMAGARRRTback to top mRNA from alignment at P-wetherbeei_contig11532:1890..2139- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11532.1.1 ID=mRNA_P-wetherbeei_contig11532.1.1|Name=mRNA_P-wetherbeei_contig11532.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=250bp|location=Sequence derived from alignment at P-wetherbeei_contig11532:1890..2139- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11532:1890..2139- >mRNA_P-wetherbeei_contig11532.1.1 ID=mRNA_P-wetherbeei_contig11532.1.1|Name=mRNA_P-wetherbeei_contig11532.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=246bp|location=Sequence derived from alignment at P-wetherbeei_contig11532:1890..2139- (Phaeothamnion wetherbeei SAG_119_79)back to top |