mRNA_P-wetherbeei_contig11508.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11508.1.1 vs. uniprot
Match: A0A7S2YMT1_9STRA (Hypothetical protein n=1 Tax=Amphiprora paludosa TaxID=265537 RepID=A0A7S2YMT1_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 7.280e-7 Identity = 25/52 (48.08%), Postives = 38/52 (73.08%), Query Frame = 1 Query: 127 IDEENFLQPEWRSLDRRLRNRRTREVGE--GPRGRSNLKKSEEDFWLEAGLY 276 ID+E+ LQP W+ ++ R++NRR R E G GR+N+KK++E+ WL+ GLY Sbjct: 63 IDDEDELQPMWKGMESRVKNRRPRTRAETGGKTGRTNIKKTDEEMWLKEGLY 114
BLAST of mRNA_P-wetherbeei_contig11508.1.1 vs. uniprot
Match: A0A7S2IA71_9STRA (Hypothetical protein n=1 Tax=Helicotheca tamesis TaxID=374047 RepID=A0A7S2IA71_9STRA) HSP 1 Score: 51.6 bits (122), Expect = 1.380e-5 Identity = 25/52 (48.08%), Postives = 35/52 (67.31%), Query Frame = 1 Query: 127 IDEENFLQPEWRSLDRRLRNRRTREVGE--GPRGRSNLKKSEEDFWLEAGLY 276 I ++ LQP WR ++ R+ RRT + E G GR N++K+EED WLEAG+Y Sbjct: 97 ISSDDELQPMWRDMESRVLKRRTYTIAESGGKVGRRNIRKTEEDVWLEAGMY 148
BLAST of mRNA_P-wetherbeei_contig11508.1.1 vs. uniprot
Match: K0RA15_THAOC (Uncharacterized protein (Fragment) n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0RA15_THAOC) HSP 1 Score: 50.4 bits (119), Expect = 5.040e-5 Identity = 26/71 (36.62%), Postives = 39/71 (54.93%), Query Frame = 1 Query: 127 IDEENFLQPEWRSLDRRLRNRR--TREVGEGPRGRSNLKKSEEDFWLEAGLYVPHPARPGLPDNEWSEKAG 333 ID +QP WR ++ R+ RR T E +G GR N++KS+ED WL+AG+Y D+ ++ G Sbjct: 102 IDNYEDVQPAWREMESRVTKRRSLTLEERQGVSGRRNVRKSDEDLWLQAGVYNSSKEEASNSDSNDDQEEG 172 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11508.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11508.1.1 >prot_P-wetherbeei_contig11508.1.1 ID=prot_P-wetherbeei_contig11508.1.1|Name=mRNA_P-wetherbeei_contig11508.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=113bp APRRRITPSLLARRWHWDGGRVRDWTVDNKGGDVQEGEGGASIDEENFLQback to top mRNA from alignment at P-wetherbeei_contig11508:2..381+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11508.1.1 ID=mRNA_P-wetherbeei_contig11508.1.1|Name=mRNA_P-wetherbeei_contig11508.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=380bp|location=Sequence derived from alignment at P-wetherbeei_contig11508:2..381+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11508:2..381+ >mRNA_P-wetherbeei_contig11508.1.1 ID=mRNA_P-wetherbeei_contig11508.1.1|Name=mRNA_P-wetherbeei_contig11508.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=339bp|location=Sequence derived from alignment at P-wetherbeei_contig11508:2..381+ (Phaeothamnion wetherbeei SAG_119_79)back to top |