mRNA_P-wetherbeei_contig10094.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10094.1.1 vs. uniprot
Match: D7FS05_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FS05_ECTSI) HSP 1 Score: 65.1 bits (157), Expect = 3.720e-11 Identity = 31/53 (58.49%), Postives = 39/53 (73.58%), Query Frame = 1 Query: 10 SSFESWLEEDLGRLNLDAEVFSGYVAGIMDDPEVPVEERVAAVNELLSGATEE 168 SSF++WL + L L LDAEV+ GYV GIM D + P EER+ +V E+LSGA EE Sbjct: 8 SSFDTWLVDKLDALGLDAEVYGGYVTGIMGDEDNPQEERIESVIEILSGAAEE 60
BLAST of mRNA_P-wetherbeei_contig10094.1.1 vs. uniprot
Match: A0A6B2E6V8_9DIPT (Coiled-coil domain-containing protein 43 n=1 Tax=Phlebotomus kandelakii TaxID=1109342 RepID=A0A6B2E6V8_9DIPT) HSP 1 Score: 53.1 bits (126), Expect = 8.260e-7 Identity = 25/55 (45.45%), Postives = 36/55 (65.45%), Query Frame = 1 Query: 4 AVSSFESWLEEDLGRLNLDAEVFSGYVAGIMD-DPEVPVEERVAAVNELLSGATE 165 A FESWL+ L ++N D ++ Y+ GI+D D E VEE+++A+ ELLSG E Sbjct: 3 AEEEFESWLKRKLRQINTDESIYGPYIVGILDGDGEEQVEEKISAIEELLSGIIE 57
BLAST of mRNA_P-wetherbeei_contig10094.1.1 vs. uniprot
Match: A0A1B0D3C6_PHLPP (Coiled-coil domain-containing protein 43 n=1 Tax=Phlebotomus papatasi TaxID=29031 RepID=A0A1B0D3C6_PHLPP) HSP 1 Score: 47.8 bits (112), Expect = 8.350e-5 Identity = 21/49 (42.86%), Postives = 33/49 (67.35%), Query Frame = 1 Query: 13 SFESWLEEDLGRLNLDAEVFSGYVAGIMD-DPEVPVEERVAAVNELLSG 156 +F+ WL+ L ++N D ++ Y+ GI+D D E VEE++ A+ ELLSG Sbjct: 7 TFDFWLKRKLRQINTDESIYGPYIVGILDGDGEEQVEEKIGAIEELLSG 55 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10094.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10094.1.1 >prot_P-wetherbeei_contig10094.1.1 ID=prot_P-wetherbeei_contig10094.1.1|Name=mRNA_P-wetherbeei_contig10094.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=63bp MAVSSFESWLEEDLGRLNLDAEVFSGYVAGIMDDPEVPVEERVAAVNELLback to top mRNA from alignment at P-wetherbeei_contig10094:34..222- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10094.1.1 ID=mRNA_P-wetherbeei_contig10094.1.1|Name=mRNA_P-wetherbeei_contig10094.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=189bp|location=Sequence derived from alignment at P-wetherbeei_contig10094:34..222- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10094:34..222- >mRNA_P-wetherbeei_contig10094.1.1 ID=mRNA_P-wetherbeei_contig10094.1.1|Name=mRNA_P-wetherbeei_contig10094.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=189bp|location=Sequence derived from alignment at P-wetherbeei_contig10094:34..222- (Phaeothamnion wetherbeei SAG_119_79)back to top |