mRNA_P-wetherbeei_contig10084.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10084.1.1 vs. uniprot
Match: A0A2Z6SP10_9GLOM (DUF659 domain-containing protein n=1 Tax=Rhizophagus clarus TaxID=94130 RepID=A0A2Z6SP10_9GLOM) HSP 1 Score: 51.6 bits (122), Expect = 4.490e-6 Identity = 25/58 (43.10%), Postives = 36/58 (62.07%), Query Frame = 1 Query: 7 FLADLFSKMIDKVGVKKVAAICTDGASAITKGRSDLVKIPKYPHIIDLRCQMHAFNLV 180 FLAD S +I+K G++K AA D S + R + + YP+IID+RC +HA NL+ Sbjct: 291 FLADQVSSIIEKTGMEKFAAFVIDSGSNCRRAREIIERT--YPYIIDMRCAVHAINLI 346 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10084.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10084.1.1 >prot_P-wetherbeei_contig10084.1.1 ID=prot_P-wetherbeei_contig10084.1.1|Name=mRNA_P-wetherbeei_contig10084.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=50bp MIDKVGVKKVAAICTDGASAITKGRSDLVKIPKYPHIIDLRCQMHAFNLVback to top mRNA from alignment at P-wetherbeei_contig10084:669..848+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10084.1.1 ID=mRNA_P-wetherbeei_contig10084.1.1|Name=mRNA_P-wetherbeei_contig10084.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=180bp|location=Sequence derived from alignment at P-wetherbeei_contig10084:669..848+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10084:669..848+ >mRNA_P-wetherbeei_contig10084.1.1 ID=mRNA_P-wetherbeei_contig10084.1.1|Name=mRNA_P-wetherbeei_contig10084.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=150bp|location=Sequence derived from alignment at P-wetherbeei_contig10084:669..848+ (Phaeothamnion wetherbeei SAG_119_79)back to top |