mRNA_P-wetherbeei_contig10058.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10058.2.1 vs. uniprot
Match: A0A7S2WBM1_9STRA (Hypothetical protein (Fragment) n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2WBM1_9STRA) HSP 1 Score: 75.1 bits (183), Expect = 3.430e-15 Identity = 34/57 (59.65%), Postives = 51/57 (89.47%), Query Frame = 1 Query: 4 QAEYFRAILALHRDDFDESSLRVDAARRLLDSTFTALVAESYKRAYTTMVTVQQLAE 174 + +FRA++A+H++ +++++L +D AR+LLD+TFTALVAESYKRAYT+MV+VQ LAE Sbjct: 112 EGPFFRAVIAVHKNRYEDAALHIDRARQLLDNTFTALVAESYKRAYTSMVSVQLLAE 168
BLAST of mRNA_P-wetherbeei_contig10058.2.1 vs. uniprot
Match: W7TTX4_9STRA (Serine/threonine-protein kinase TOR n=3 Tax=Monodopsidaceae TaxID=425072 RepID=W7TTX4_9STRA) HSP 1 Score: 73.2 bits (178), Expect = 1.040e-13 Identity = 35/54 (64.81%), Postives = 46/54 (85.19%), Query Frame = 1 Query: 13 YFRAILALHRDDFDESSLRVDAARRLLDSTFTALVAESYKRAYTTMVTVQQLAE 174 ++RAILALH +DF+ +++ +D ARRLLD+TFTALV+ESY RAY +MV QQLAE Sbjct: 1500 FYRAILALHNEDFEAAAVNIDHARRLLDTTFTALVSESYNRAYMSMVQFQQLAE 1553
BLAST of mRNA_P-wetherbeei_contig10058.2.1 vs. uniprot
Match: A0A835YM18_9STRA (Serine/threonine-protein kinase TOR n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YM18_9STRA) HSP 1 Score: 70.9 bits (172), Expect = 6.740e-13 Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1 Query: 25 ILALHRDDFDESSLRVDAARRLLDSTFTALVAESYKRAYTTMVTVQQLAE 174 +LALH DDF+ ++L+VD ARRLLD+TF ALVAESY RAY+ MV VQQLAE Sbjct: 1197 VLALHGDDFERTALQVDLARRLLDNTFAALVAESYTRAYSHMVMVQQLAE 1246
BLAST of mRNA_P-wetherbeei_contig10058.2.1 vs. uniprot
Match: A0A0W4ZU42_PNEJ7 (Serine/threonine-protein kinase TOR n=3 Tax=Pneumocystis TaxID=4753 RepID=A0A0W4ZU42_PNEJ7) HSP 1 Score: 68.6 bits (166), Expect = 4.400e-12 Identity = 34/58 (58.62%), Postives = 42/58 (72.41%), Query Frame = 1 Query: 1 PQAEYFRAILALHRDDFDESSLRVDAARRLLDSTFTALVAESYKRAYTTMVTVQQLAE 174 P +FRAI++LHR+ F+E+SL + AR LLD+ FTALV ESY RAY V VQ LAE Sbjct: 1391 PDRSFFRAIISLHRNQFNETSLHITKARELLDTEFTALVGESYNRAYCVAVRVQMLAE 1448
BLAST of mRNA_P-wetherbeei_contig10058.2.1 vs. uniprot
Match: A0A7S2P9Q5_9STRA (Serine/threonine-protein kinase TOR (Fragment) n=1 Tax=Skeletonema marinoi TaxID=267567 RepID=A0A7S2P9Q5_9STRA) HSP 1 Score: 67.8 bits (164), Expect = 8.220e-12 Identity = 29/54 (53.70%), Postives = 46/54 (85.19%), Query Frame = 1 Query: 13 YFRAILALHRDDFDESSLRVDAARRLLDSTFTALVAESYKRAYTTMVTVQQLAE 174 ++RA++ +HR+++DE+++ +DAAR+ +DS FTAL+AESYKRAY +MV Q L+E Sbjct: 1650 FYRAVINIHREEWDEAAISIDAARKAMDSRFTALLAESYKRAYPSMVAAQTLSE 1703
BLAST of mRNA_P-wetherbeei_contig10058.2.1 vs. uniprot
Match: A0A7S1UB55_9STRA (Hypothetical protein (Fragment) n=1 Tax=Phaeomonas parva TaxID=124430 RepID=A0A7S1UB55_9STRA) HSP 1 Score: 65.9 bits (159), Expect = 3.870e-11 Identity = 35/53 (66.04%), Postives = 38/53 (71.70%), Query Frame = 1 Query: 16 FRAILALHRDDFDESSLRVDAARRLLDSTFTALVAESYKRAYTTMVTVQQLAE 174 + AIL L DFD +D RRLLD TFTALVAESY+RAYT MVT QQLAE Sbjct: 373 YNAILKLRSGDFDACVRYIDDCRRLLDGTFTALVAESYRRAYTAMVTAQQLAE 425
BLAST of mRNA_P-wetherbeei_contig10058.2.1 vs. uniprot
Match: D7G264_ECTSI (Non-specific serine/threonine protein kinase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G264_ECTSI) HSP 1 Score: 65.9 bits (159), Expect = 3.920e-11 Identity = 32/57 (56.14%), Postives = 44/57 (77.19%), Query Frame = 1 Query: 4 QAEYFRAILALHRDDFDESSLRVDAARRLLDSTFTALVAESYKRAYTTMVTVQQLAE 174 + Y RA+LAL ++D ++ + V+ AR+LLD+TFT L+ ESYKRAY +MV VQQLAE Sbjct: 1661 EGAYLRAVLALRKEDLEQCTRFVNHARQLLDNTFTTLIGESYKRAYNSMVMVQQLAE 1717
BLAST of mRNA_P-wetherbeei_contig10058.2.1 vs. uniprot
Match: A0A7R9UF45_9STRA (Hypothetical protein (Fragment) n=2 Tax=Pinguiococcus pyrenoidosus TaxID=172671 RepID=A0A7R9UF45_9STRA) HSP 1 Score: 65.5 bits (158), Expect = 5.320e-11 Identity = 34/53 (64.15%), Postives = 39/53 (73.58%), Query Frame = 1 Query: 16 FRAILALHRDDFDESSLRVDAARRLLDSTFTALVAESYKRAYTTMVTVQQLAE 174 + AIL L DFD + +D +RRLLD TFTALVAESY+RAY MVT QQLAE Sbjct: 525 YNAILKLRSGDFDACAKYIDDSRRLLDGTFTALVAESYRRAYNAMVTAQQLAE 577
BLAST of mRNA_P-wetherbeei_contig10058.2.1 vs. uniprot
Match: B8CAU9_THAPS (Serine/threonine-protein kinase TOR n=1 Tax=Thalassiosira pseudonana TaxID=35128 RepID=B8CAU9_THAPS) HSP 1 Score: 65.5 bits (158), Expect = 5.360e-11 Identity = 30/54 (55.56%), Postives = 44/54 (81.48%), Query Frame = 1 Query: 13 YFRAILALHRDDFDESSLRVDAARRLLDSTFTALVAESYKRAYTTMVTVQQLAE 174 ++RA+L +HR ++DE++ +DAAR+ +DS FTAL+AESYKRAY +MV Q L+E Sbjct: 1444 FYRAVLHIHRAEWDEANSAIDAARKAMDSRFTALLAESYKRAYPSMVAAQTLSE 1497
BLAST of mRNA_P-wetherbeei_contig10058.2.1 vs. uniprot
Match: S8BMS0_DACHA (Serine/threonine-protein kinase TOR n=1 Tax=Dactylellina haptotyla (strain CBS 200.50) TaxID=1284197 RepID=S8BMS0_DACHA) HSP 1 Score: 65.1 bits (157), Expect = 7.300e-11 Identity = 33/58 (56.90%), Postives = 42/58 (72.41%), Query Frame = 1 Query: 1 PQAEYFRAILALHRDDFDESSLRVDAARRLLDSTFTALVAESYKRAYTTMVTVQQLAE 174 P +F AILALHR+ FDE++L ++ AR LDS +ALV ESY RAY+ +V VQ LAE Sbjct: 1352 PDRSFFGAILALHRNHFDEATLHIEKAREGLDSELSALVGESYSRAYSVIVRVQMLAE 1409 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10058.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10058.2.1 >prot_P-wetherbeei_contig10058.2.1 ID=prot_P-wetherbeei_contig10058.2.1|Name=mRNA_P-wetherbeei_contig10058.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=58bp PQAEYFRAILALHRDDFDESSLRVDAARRLLDSTFTALVAESYKRAYTTMback to top mRNA from alignment at P-wetherbeei_contig10058:2243..2416+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10058.2.1 ID=mRNA_P-wetherbeei_contig10058.2.1|Name=mRNA_P-wetherbeei_contig10058.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=174bp|location=Sequence derived from alignment at P-wetherbeei_contig10058:2243..2416+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10058:2243..2416+ >mRNA_P-wetherbeei_contig10058.2.1 ID=mRNA_P-wetherbeei_contig10058.2.1|Name=mRNA_P-wetherbeei_contig10058.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=174bp|location=Sequence derived from alignment at P-wetherbeei_contig10058:2243..2416+ (Phaeothamnion wetherbeei SAG_119_79)back to top |