prot_P-wetherbeei_contig9938.3.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9938.3.1 vs. uniprot
Match: A0A7X8XKX1_9BURK (DNA polymerase III subunit delta n=1 Tax=Burkholderiales bacterium TaxID=1891238 RepID=A0A7X8XKX1_9BURK) HSP 1 Score: 82.0 bits (201), Expect = 7.070e-17 Identity = 38/71 (53.52%), Postives = 52/71 (73.24%), Query Frame = 0 Query: 1 KLPESLLYHVTGPDDYLREEVLARLKRELLDPDFGDFNFRSVRCASNLKLSLLQDALAELPVMTDRRVLEL 71 +LPE+ L+ + GPDD+LRE+VL RL+ E+LDP F DFN + C S K + + AL ELP+MTDRR++EL Sbjct: 8 RLPEASLFLLAGPDDFLREQVLNRLRHEVLDPGFADFNHCRIHCTSGTKSATILAALFELPMMTDRRLVEL 78
BLAST of mRNA_P-wetherbeei_contig9938.3.1 vs. uniprot
Match: A0A355TQL0_9BACT (DNA polymerase III subunit delta (Fragment) n=1 Tax=bacterium UBP9_UBA11836 TaxID=2060920 RepID=A0A355TQL0_9BACT) HSP 1 Score: 68.2 bits (165), Expect = 8.150e-12 Identity = 30/71 (42.25%), Postives = 49/71 (69.01%), Query Frame = 0 Query: 1 KLPESLLYHVTGPDDYLREEVLARLKRELLDPDFGDFNFRSVRCASNLKLSLLQDALAELPVMTDRRVLEL 71 K+ E+ Y + G D+YL E + L+ ++D DFGDFN+ + C+ + K++ L +AL ELP++TD+R+LEL Sbjct: 10 KIKEATAYILYGEDEYLISETMHLLRNSVIDADFGDFNYTRLECSGSTKVAELVNALRELPMLTDKRLLEL 80 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9938.3.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig9938.3.1 ID=prot_P-wetherbeei_contig9938.3.1|Name=mRNA_P-wetherbeei_contig9938.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=71bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|