prot_P-wetherbeei_contig9858.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9858.1.1 vs. uniprot
Match: A0A1V9ZV51_9STRA (Uncharacterized protein n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1V9ZV51_9STRA) HSP 1 Score: 73.2 bits (178), Expect = 6.300e-14 Identity = 37/80 (46.25%), Postives = 52/80 (65.00%), Query Frame = 0 Query: 5 LAHSLREAAALVGVGGPTHLILRASPDLLCRNLFCEHVGGPCTCRLAMSLEKVQNVEVLDISDNSLKVLPDVICALQKLR 84 +A SLR+AA L+LR S DL+CRNL CE VG C C+L++ LE++ +E LD+S+N L++LP I L KL+ Sbjct: 2 IAKSLRDAA--THTSSVQKLVLRKSQDLVCRNLMCERVGEACVCKLSLVLERLPQLEELDVSENKLQMLPPSIFQLSKLK 79
BLAST of mRNA_P-wetherbeei_contig9858.1.1 vs. uniprot
Match: A0A225WFI4_9STRA (Uncharacterized protein n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225WFI4_9STRA) HSP 1 Score: 71.6 bits (174), Expect = 4.750e-13 Identity = 32/61 (52.46%), Postives = 44/61 (72.13%), Query Frame = 0 Query: 24 LILRASPDLLCRNLFCEHVGGPCTCRLAMSLEKVQNVEVLDISDNSLKVLPDVICALQKLR 84 L L S DL+CR L CEHVG C CRLA++LE+V +++LD+S N L+ LPD + AL+ L+ Sbjct: 43 LELPQSGDLVCRQLMCEHVGDACACRLALALERVPRLQLLDLSANQLRDLPDAVFALKSLK 103
BLAST of mRNA_P-wetherbeei_contig9858.1.1 vs. uniprot
Match: A0A662XZS3_9STRA (Uncharacterized protein n=1 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662XZS3_9STRA) HSP 1 Score: 70.9 bits (172), Expect = 1.330e-12 Identity = 32/60 (53.33%), Postives = 44/60 (73.33%), Query Frame = 0 Query: 24 LILRASPDLLCRNLFCEHVGGPCTCRLAMSLEKVQNVEVLDISDNSLKVLPDVICALQKL 83 L L SPDL+CRNL CEHVG C CRL++ LE+V ++ LD+S+N+L+ LP +LQ+L Sbjct: 53 LQLPQSPDLVCRNLMCEHVGDACACRLSLVLERVPQLQRLDLSNNALRALPASTFSLQEL 112
BLAST of mRNA_P-wetherbeei_contig9858.1.1 vs. uniprot
Match: T0QH27_SAPDV (Uncharacterized protein n=1 Tax=Saprolegnia diclina (strain VS20) TaxID=1156394 RepID=T0QH27_SAPDV) HSP 1 Score: 69.7 bits (169), Expect = 1.510e-12 Identity = 37/79 (46.84%), Postives = 50/79 (63.29%), Query Frame = 0 Query: 5 LAHSLREAAALVGVGGPTHLILRASPDLLCRNLFCEHVGGPCTCRLAMSLEKVQNVEVLDISDNSLKVLPDVICALQKL 83 +A SLR+AA L+LR S DLLC NL CE VG C C+L++ LE++ +E LD+S N+LK LP I +L+ L Sbjct: 2 IAKSLRDAA--THTSAVRQLVLRKSEDLLCMNLMCERVGEACVCKLSVVLERLPQLEHLDVSRNNLKSLPPAIFSLRHL 78
BLAST of mRNA_P-wetherbeei_contig9858.1.1 vs. uniprot
Match: A0A662YEN8_9STRA (Uncharacterized protein n=1 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662YEN8_9STRA) HSP 1 Score: 69.3 bits (168), Expect = 5.120e-12 Identity = 31/59 (52.54%), Postives = 42/59 (71.19%), Query Frame = 0 Query: 24 LILRASPDLLCRNLFCEHVGGPCTCRLAMSLEKVQNVEVLDISDNSLKVLPDVICALQK 82 L L SPDL+CRNL CEHVG C CRL++ LE+V ++ LD+S N+L+ LP +LQ+ Sbjct: 53 LQLPQSPDLVCRNLMCEHVGDACACRLSLVLERVPQLQQLDLSSNALRALPASTFSLQE 111
BLAST of mRNA_P-wetherbeei_contig9858.1.1 vs. uniprot
Match: K3WPL3_GLOUD (Uncharacterized protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3WPL3_GLOUD) HSP 1 Score: 67.4 bits (163), Expect = 1.780e-11 Identity = 32/73 (43.84%), Postives = 49/73 (67.12%), Query Frame = 0 Query: 4 RLAHSLREAAALVGVGGPTH-LILRASPDLLCRNLFCEHVGGPCTCRLAMSLEKVQNVEVLDISDNSLKVLPD 75 R A SLRE V G H L+L +S DL+C+N+ CEHVG C C+L++ LE++ ++ +D+S+N L+ LP+ Sbjct: 18 RTARSLRE----VARGHAVHSLLLPSSQDLICKNMMCEHVGSSCACKLSLVLERLPQLQEMDLSNNKLRFLPE 86
BLAST of mRNA_P-wetherbeei_contig9858.1.1 vs. uniprot
Match: A0A067CF62_SAPPC (Uncharacterized protein n=1 Tax=Saprolegnia parasitica (strain CBS 223.65) TaxID=695850 RepID=A0A067CF62_SAPPC) HSP 1 Score: 67.4 bits (163), Expect = 1.340e-10 Identity = 36/79 (45.57%), Postives = 49/79 (62.03%), Query Frame = 0 Query: 5 LAHSLREAAALVGVGGPTHLILRASPDLLCRNLFCEHVGGPCTCRLAMSLEKVQNVEVLDISDNSLKVLPDVICALQKL 83 +A SLR+AA L+LR S DLLC NL CE VG C C+L++ LE++ +E LD+S N+L LP I +L+ L Sbjct: 383 IAKSLRDAA--THTSAVRQLVLRKSEDLLCMNLMCERVGEACVCKLSVVLERLPQLEHLDVSRNNLMSLPPAIFSLRHL 459 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9858.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 7
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig9858.1.1 ID=prot_P-wetherbeei_contig9858.1.1|Name=mRNA_P-wetherbeei_contig9858.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=124bpback to top |