prot_P-wetherbeei_contig9604.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9604.2.1 vs. uniprot
Match: A0A6H5JAA6_9PHAE (RING-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JAA6_9PHAE) HSP 1 Score: 53.9 bits (128), Expect = 8.960e-7 Identity = 27/58 (46.55%), Postives = 38/58 (65.52%), Query Frame = 0 Query: 4 DILASLTTCPAGCQRMLPLLLPQVNTMAHAALERRFPAEYARRLADAVAWQADVAFVR 61 ++ A+ +CPAGCQRM+PL+LP+V TM L R FP+ Y RL + +A V+ VR Sbjct: 484 NVRANRISCPAGCQRMIPLVLPEVTTMVQKLLTRGFPSAYRERLQETEPERALVSQVR 541
BLAST of mRNA_P-wetherbeei_contig9604.2.1 vs. uniprot
Match: D7G4J4_ECTSI (RING-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G4J4_ECTSI) HSP 1 Score: 53.5 bits (127), Expect = 1.220e-6 Identity = 27/58 (46.55%), Postives = 38/58 (65.52%), Query Frame = 0 Query: 4 DILASLTTCPAGCQRMLPLLLPQVNTMAHAALERRFPAEYARRLADAVAWQADVAFVR 61 ++ A+ +CPAGCQRM+PL+LP+V TM L R FP+ Y RL + +A V+ VR Sbjct: 229 NLRANRISCPAGCQRMIPLVLPEVTTMVQKLLTRGFPSAYRERLQETEPERALVSQVR 286 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9604.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig9604.2.1 ID=prot_P-wetherbeei_contig9604.2.1|Name=mRNA_P-wetherbeei_contig9604.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=66bpback to top |