prot_P-wetherbeei_contig960.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig960.1.1 vs. uniprot
Match: A0A835ZE28_9STRA (PH domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZE28_9STRA) HSP 1 Score: 105 bits (263), Expect = 9.060e-28 Identity = 50/60 (83.33%), Postives = 53/60 (88.33%), Query Frame = 0 Query: 1 DCNNPDFAGWLTKQSTWLKDWRRRFFILKGSKLYFAKVSHTSSEYAAPHGMIDLSSCMTV 60 DCNNPDF G+LTKQS+WLKDWRRRFFILKGSKL+FAK SE AAPHGMIDLSSCMTV Sbjct: 19 DCNNPDFTGYLTKQSSWLKDWRRRFFILKGSKLFFAK-----SEMAAPHGMIDLSSCMTV 73
BLAST of mRNA_P-wetherbeei_contig960.1.1 vs. uniprot
Match: D8LJR4_ECTSI (PH domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJR4_ECTSI) HSP 1 Score: 96.7 bits (239), Expect = 4.190e-24 Identity = 44/60 (73.33%), Postives = 47/60 (78.33%), Query Frame = 0 Query: 1 DCNNPDFAGWLTKQSTWLKDWRRRFFILKGSKLYFAKVSHTSSEYAAPHGMIDLSSCMTV 60 DCNNPD AGWL K+S WLKDWR RFF+LKGS L+FAK SEY PHG IDLSSCMTV Sbjct: 20 DCNNPDHAGWLRKESVWLKDWRPRFFVLKGSNLFFAK-----SEYETPHGRIDLSSCMTV 74
BLAST of mRNA_P-wetherbeei_contig960.1.1 vs. uniprot
Match: W7TJA6_9STRA (Pleckstrin like protein n=2 Tax=Monodopsidaceae TaxID=425072 RepID=W7TJA6_9STRA) HSP 1 Score: 95.5 bits (236), Expect = 1.070e-23 Identity = 44/60 (73.33%), Postives = 50/60 (83.33%), Query Frame = 0 Query: 1 DCNNPDFAGWLTKQSTWLKDWRRRFFILKGSKLYFAKVSHTSSEYAAPHGMIDLSSCMTV 60 D NN DF GWLTKQS+WLK+WRRR+FILKGSKL+FAK +E +PHGMIDLSSCMTV Sbjct: 15 DTNNADFEGWLTKQSSWLKEWRRRYFILKGSKLFFAK-----NEMCSPHGMIDLSSCMTV 69
BLAST of mRNA_P-wetherbeei_contig960.1.1 vs. uniprot
Match: A0A7S1CZ96_CYCTE (Hypothetical protein n=2 Tax=Cyclophora tenuis TaxID=216820 RepID=A0A7S1CZ96_CYCTE) HSP 1 Score: 94.0 bits (232), Expect = 1.800e-22 Identity = 43/60 (71.67%), Postives = 48/60 (80.00%), Query Frame = 0 Query: 1 DCNNPDFAGWLTKQSTWLKDWRRRFFILKGSKLYFAKVSHTSSEYAAPHGMIDLSSCMTV 60 D NN DF GWLTKQS WLKDWRRR+FILKGSKL+F+K + Y+APHGMIDLS C TV Sbjct: 46 DTNNADFEGWLTKQSMWLKDWRRRYFILKGSKLFFSKTN-----YSAPHGMIDLSQCTTV 100
BLAST of mRNA_P-wetherbeei_contig960.1.1 vs. uniprot
Match: A0A7S3LD69_9STRA (Hypothetical protein n=1 Tax=Amphora coffeiformis TaxID=265554 RepID=A0A7S3LD69_9STRA) HSP 1 Score: 92.4 bits (228), Expect = 5.440e-22 Identity = 40/60 (66.67%), Postives = 50/60 (83.33%), Query Frame = 0 Query: 1 DCNNPDFAGWLTKQSTWLKDWRRRFFILKGSKLYFAKVSHTSSEYAAPHGMIDLSSCMTV 60 D N+P++ GWLTKQSTWLK+WRRR+FILKGSKL++ K +EY+ PHGMIDL+SC TV Sbjct: 40 DVNDPEYEGWLTKQSTWLKEWRRRYFILKGSKLFYCK-----NEYSGPHGMIDLASCTTV 94
BLAST of mRNA_P-wetherbeei_contig960.1.1 vs. uniprot
Match: A0A7S2AKD7_9STRA (Hypothetical protein n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2AKD7_9STRA) HSP 1 Score: 91.3 bits (225), Expect = 6.640e-22 Identity = 40/60 (66.67%), Postives = 49/60 (81.67%), Query Frame = 0 Query: 1 DCNNPDFAGWLTKQSTWLKDWRRRFFILKGSKLYFAKVSHTSSEYAAPHGMIDLSSCMTV 60 + ++PDF GWLTKQSTW+K+WRRR+FILKGSKL+FAK E A PHGM+DL+ CMTV Sbjct: 32 ETSDPDFQGWLTKQSTWIKEWRRRYFILKGSKLFFAK-----GEAATPHGMVDLAQCMTV 86
BLAST of mRNA_P-wetherbeei_contig960.1.1 vs. uniprot
Match: A0A7R9ZAF4_9STRA (Hypothetical protein n=1 Tax=Pseudictyota dubia TaxID=2749911 RepID=A0A7R9ZAF4_9STRA) HSP 1 Score: 92.4 bits (228), Expect = 9.190e-22 Identity = 41/60 (68.33%), Postives = 49/60 (81.67%), Query Frame = 0 Query: 1 DCNNPDFAGWLTKQSTWLKDWRRRFFILKGSKLYFAKVSHTSSEYAAPHGMIDLSSCMTV 60 D +NP++ GWLTKQS WLKDWRRR+FILKGSKL+FAK+ H+ APHGMIDL+ C TV Sbjct: 57 DTDNPEYEGWLTKQSMWLKDWRRRYFILKGSKLFFAKLPHS-----APHGMIDLAQCTTV 111
BLAST of mRNA_P-wetherbeei_contig960.1.1 vs. uniprot
Match: A0A7S2A403_TRICV (Hypothetical protein n=1 Tax=Trieres chinensis TaxID=1514140 RepID=A0A7S2A403_TRICV) HSP 1 Score: 89.7 bits (221), Expect = 1.680e-20 Identity = 38/60 (63.33%), Postives = 48/60 (80.00%), Query Frame = 0 Query: 1 DCNNPDFAGWLTKQSTWLKDWRRRFFILKGSKLYFAKVSHTSSEYAAPHGMIDLSSCMTV 60 DC++P++ GWLTKQS WLKDWRRR+F+LKGSKL+F K H++ PHGMIDL+ C TV Sbjct: 91 DCSDPEYEGWLTKQSMWLKDWRRRYFLLKGSKLFFCKSPHST-----PHGMIDLAKCTTV 145
BLAST of mRNA_P-wetherbeei_contig960.1.1 vs. uniprot
Match: A0A7S2R6Y3_9STRA (Hypothetical protein n=1 Tax=Eucampia antarctica TaxID=49252 RepID=A0A7S2R6Y3_9STRA) HSP 1 Score: 87.0 bits (214), Expect = 3.380e-20 Identity = 42/60 (70.00%), Postives = 47/60 (78.33%), Query Frame = 0 Query: 1 DCNNPDFAGWLTKQSTWLKDWRRRFFILKGSKLYFAKVSHTSSEYAAPHGMIDLSSCMTV 60 + N DF G+LTKQS WLKDWRRRFFILKGSKL+F+K SE A PHGMIDLS+C TV Sbjct: 19 ETNQADFEGYLTKQSQWLKDWRRRFFILKGSKLFFSK-----SERARPHGMIDLSTCTTV 73
BLAST of mRNA_P-wetherbeei_contig960.1.1 vs. uniprot
Match: UPI000711B6F5 (pleckstrin-likey domain-containing protein n=1 Tax=Blastocystis sp. subtype 4 TaxID=944170 RepID=UPI000711B6F5) HSP 1 Score: 85.5 bits (210), Expect = 4.830e-20 Identity = 37/58 (63.79%), Postives = 44/58 (75.86%), Query Frame = 0 Query: 3 NNPDFAGWLTKQSTWLKDWRRRFFILKGSKLYFAKVSHTSSEYAAPHGMIDLSSCMTV 60 ++P+F G+LTK+S WLK WRRR+FILKG KLYFAK S + PHGMIDLS C TV Sbjct: 11 SHPEFTGYLTKRSAWLKTWRRRYFILKGDKLYFAKSKDVRSVFVPPHGMIDLSKCQTV 68 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig960.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig960.1.1 ID=prot_P-wetherbeei_contig960.1.1|Name=mRNA_P-wetherbeei_contig960.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=68bpback to top |