prot_P-wetherbeei_contig9538.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9538.1.1 vs. uniprot
Match: A0A836CN06_9STRA (Myb-like domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CN06_9STRA) HSP 1 Score: 80.5 bits (197), Expect = 3.210e-16 Identity = 38/63 (60.32%), Postives = 44/63 (69.84%), Query Frame = 0 Query: 50 SQLPWTEIEDWLVQDTFPRRVVVSKMLADSLYAIGSGKHVMWRRMVMEVPELLGRTPAQARSR 112 + +PWTE EDWL+QDTF R YAIGSGKHV+W RMV EVPEL+GRTP +AR R Sbjct: 22 ADMPWTEFEDWLLQDTFAR------------YAIGSGKHVLWNRMVTEVPELIGRTPQEARRR 72
BLAST of mRNA_P-wetherbeei_contig9538.1.1 vs. uniprot
Match: D7G8N9_ECTSI (Myb-like domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G8N9_ECTSI) HSP 1 Score: 77.0 bits (188), Expect = 2.740e-14 Identity = 44/87 (50.57%), Postives = 53/87 (60.92%), Query Frame = 0 Query: 28 RWAADASSPNAAGV--WTDPADAMSQLPWTEIEDWLVQDTFPRRVVVSKMLADSLYAIGSGKHVMWRRMVMEVPELLGRTPAQARSR 112 +W +A+ N AG W A+A WTE EDWL+QDT+ R YAIGSGKHV+WRRMV EVPEL+ RTP +AR R Sbjct: 145 KWG-EAAEGNLAGEFEWEGGAEAA----WTEFEDWLLQDTYSR------------YAIGSGKHVLWRRMVREVPELMERTPQEARER 214 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9538.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig9538.1.1 ID=prot_P-wetherbeei_contig9538.1.1|Name=mRNA_P-wetherbeei_contig9538.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=113bpback to top |