mRNA_P-wetherbeei_contig9538.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9538.1.1 vs. uniprot
Match: A0A836CN06_9STRA (Myb-like domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CN06_9STRA) HSP 1 Score: 80.5 bits (197), Expect = 3.210e-16 Identity = 38/63 (60.32%), Postives = 44/63 (69.84%), Query Frame = 1 Query: 148 SQLPWTEIEDWLVQDTFPRRVVVSKMLADSLYAIGSGKHVMWRRMVMEVPELLGRTPAQARSR 336 + +PWTE EDWL+QDTF R YAIGSGKHV+W RMV EVPEL+GRTP +AR R Sbjct: 22 ADMPWTEFEDWLLQDTFAR------------YAIGSGKHVLWNRMVTEVPELIGRTPQEARRR 72
BLAST of mRNA_P-wetherbeei_contig9538.1.1 vs. uniprot
Match: D7G8N9_ECTSI (Myb-like domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G8N9_ECTSI) HSP 1 Score: 77.0 bits (188), Expect = 2.740e-14 Identity = 44/87 (50.57%), Postives = 53/87 (60.92%), Query Frame = 1 Query: 82 RWAADASSPNAAGV--WTDPADAMSQLPWTEIEDWLVQDTFPRRVVVSKMLADSLYAIGSGKHVMWRRMVMEVPELLGRTPAQARSR 336 +W +A+ N AG W A+A WTE EDWL+QDT+ R YAIGSGKHV+WRRMV EVPEL+ RTP +AR R Sbjct: 145 KWG-EAAEGNLAGEFEWEGGAEAA----WTEFEDWLLQDTYSR------------YAIGSGKHVLWRRMVREVPELMERTPQEARER 214 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9538.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9538.1.1 >prot_P-wetherbeei_contig9538.1.1 ID=prot_P-wetherbeei_contig9538.1.1|Name=mRNA_P-wetherbeei_contig9538.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=113bp GGGGGGALWGGGSSSRSSSGGGGNGGARWAADASSPNAAGVWTDPADAMSback to top mRNA from alignment at P-wetherbeei_contig9538:1931..2511+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9538.1.1 ID=mRNA_P-wetherbeei_contig9538.1.1|Name=mRNA_P-wetherbeei_contig9538.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=581bp|location=Sequence derived from alignment at P-wetherbeei_contig9538:1931..2511+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9538:1931..2511+ >mRNA_P-wetherbeei_contig9538.1.1 ID=mRNA_P-wetherbeei_contig9538.1.1|Name=mRNA_P-wetherbeei_contig9538.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=339bp|location=Sequence derived from alignment at P-wetherbeei_contig9538:1931..2511+ (Phaeothamnion wetherbeei SAG_119_79)back to top |