|
|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
| IPR019734 | Tetratricopeptide repeat | SMART | SM00028 | tpr_5 | coord: 56..89 e-value: 2.5E-5 score: 33.7 coord: 130..163 e-value: 0.0019 score: 27.5 coord: 22..55 e-value: 1.2E-4 score: 31.4 coord: 90..129 e-value: 310.0 score: 1.8 |
| IPR019734 | Tetratricopeptide repeat | PFAM | PF13181 | TPR_8 | coord: 133..163 e-value: 0.08 score: 13.2 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 22..55 score: 8.7619 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 56..89 score: 11.062901 |
| None | No IPR available | PFAM | PF13414 | TPR_11 | coord: 3..34 e-value: 1.9E-7 score: 30.7 |
| None | No IPR available | PANTHER | PTHR44858:SF1 | TETRATRICOPEPTIDE REPEAT PROTEIN 6 | coord: 5..128 |
| None | No IPR available | PANTHER | PTHR44858 | TETRATRICOPEPTIDE REPEAT PROTEIN 6 | coord: 5..128 |
| None | No IPR available | PANTHER | PTHR44858 | TETRATRICOPEPTIDE REPEAT PROTEIN 6 | coord: 69..169 |
| None | No IPR available | PANTHER | PTHR44858:SF1 | TETRATRICOPEPTIDE REPEAT PROTEIN 6 | coord: 69..169 |
| IPR001440 | Tetratricopeptide repeat 1 | PFAM | PF00515 | TPR_1 | coord: 56..89 e-value: 5.5E-7 score: 29.1 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | Tetratricopeptide repeat domain | coord: 1..41 e-value: 4.8E-11 score: 44.8 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | Tetratricopeptide repeat domain | coord: 42..104 e-value: 2.2E-16 score: 61.8 coord: 105..173 e-value: 2.1E-16 score: 61.9 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | SUPERFAMILY | 48452 | TPR-like | coord: 3..172 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig55790.1.1 ID=prot_P-wetherbeei_contig55790.1.1|Name=mRNA_P-wetherbeei_contig55790.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=173bp KEDHDAAIADCTEAIKIDPKYDWAYNNRGVAYYGLHDYDAALADHAEAIR LNRKDAWAYARRGMAWTEKGEFDRAIADLTEAVTIDPKYAFGFGQRGHAL FRKRLITKKGGWEPVIADYSEAIRLDPTLLWLYSSRGVAYSNNRRYDLAV ADCSEVIKREPQNFAGYNCRGVA back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|