prot_P-wetherbeei_contig1288.2.3 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1288.2.3 vs. uniprot
Match: A0A835YZF9_9STRA (RmlC-like cupin domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YZF9_9STRA) HSP 1 Score: 87.4 bits (215), Expect = 3.240e-18 Identity = 40/67 (59.70%), Postives = 50/67 (74.63%), Query Frame = 0 Query: 47 GVLTTFIEENGGGNITDTVYAGKISFSPQGLTHFELKIGCTPALLISAFRDDDFSVQQTSTTALAGL 113 GVLT F+EENGG I +TV AG+ +F PQGLTH ++ +GCTPA +I+A DDF VQ +TTAL GL Sbjct: 78 GVLTAFVEENGGRTIENTVVAGEAAFFPQGLTHMQVNMGCTPATMIAALGSDDFGVQTITTTALEGL 144
BLAST of mRNA_P-wetherbeei_contig1288.2.3 vs. uniprot
Match: A0A836CNU2_9STRA (RmlC-like cupin domain-containing protein n=7 Tax=Tribonema minus TaxID=303371 RepID=A0A836CNU2_9STRA) HSP 1 Score: 85.1 bits (209), Expect = 6.910e-17 Identity = 38/67 (56.72%), Postives = 49/67 (73.13%), Query Frame = 0 Query: 47 GVLTTFIEENGGGNITDTVYAGKISFSPQGLTHFELKIGCTPALLISAFRDDDFSVQQTSTTALAGL 113 GVLT F+EENGG I +T+ G+ +F PQGLTH ++ +GCTPA +I+A DDF VQ +TTAL GL Sbjct: 129 GVLTAFVEENGGRTIENTIVTGEAAFFPQGLTHVQVNMGCTPATMIAALGSDDFGVQTITTTALKGL 195
BLAST of mRNA_P-wetherbeei_contig1288.2.3 vs. uniprot
Match: A0A835Z488_9STRA (RmlC-like cupin domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z488_9STRA) HSP 1 Score: 79.7 bits (195), Expect = 7.330e-15 Identity = 35/67 (52.24%), Postives = 47/67 (70.15%), Query Frame = 0 Query: 47 GVLTTFIEENGGGNITDTVYAGKISFSPQGLTHFELKIGCTPALLISAFRDDDFSVQQTSTTALAGL 113 GVLT F+EENGG I +T+ G+ +F PQGLTH ++ +GC PA +I+A DDF VQ ++ AL GL Sbjct: 130 GVLTAFVEENGGRTIENTIVTGEAAFFPQGLTHVQVNMGCAPATMIAALGSDDFGVQTITSAALKGL 196 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1288.2.3 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig1288.2.3 ID=prot_P-wetherbeei_contig1288.2.3|Name=mRNA_P-wetherbeei_contig1288.2.3|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=185bpback to top |