prot_P-wetherbeei_contig12303.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12303.1.1 vs. uniprot
Match: E8Z6K5_PFIPI (Glutathione S-transferase (Fragment) n=1 Tax=Pfiesteria piscicida TaxID=71001 RepID=E8Z6K5_PFIPI) HSP 1 Score: 58.2 bits (139), Expect = 6.050e-9 Identity = 24/36 (66.67%), Postives = 30/36 (83.33%), Query Frame = 0 Query: 2 YPALRAWLDRIEARPAVQRGLKINSSSEGGIPEYHS 37 Y +RAW D+I ARPAV++GL+INSSS+ GI EYHS Sbjct: 211 YKNVRAWFDKISARPAVEKGLRINSSSDNGIREYHS 246
BLAST of mRNA_P-wetherbeei_contig12303.1.1 vs. uniprot
Match: A0A0G4GYH4_9ALVE (Uncharacterized protein n=1 Tax=Chromera velia CCMP2878 TaxID=1169474 RepID=A0A0G4GYH4_9ALVE) HSP 1 Score: 51.2 bits (121), Expect = 1.520e-7 Identity = 21/37 (56.76%), Postives = 27/37 (72.97%), Query Frame = 0 Query: 1 TYPALRAWLDRIEARPAVQRGLKINSSSEGGIPEYHS 37 +Y L W+DR+ +RPAV+RGL +NS S GGI E HS Sbjct: 20 SYKNLNGWMDRVGSRPAVKRGLLVNSGSPGGIKERHS 56
BLAST of mRNA_P-wetherbeei_contig12303.1.1 vs. uniprot
Match: A0A7S3PBB9_9STRA (Hypothetical protein n=2 Tax=Sar TaxID=2698737 RepID=A0A7S3PBB9_9STRA) HSP 1 Score: 47.0 bits (110), Expect = 7.580e-5 Identity = 19/37 (51.35%), Postives = 25/37 (67.57%), Query Frame = 0 Query: 2 YPALRAWLDRIEARPAVQRGLKINSSSEGGIPEYHSK 38 Y + W++ IE RPAV+RGLK+N E +PE HSK Sbjct: 258 YENVIRWIENIEERPAVKRGLKVNGWGENDLPERHSK 294 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12303.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig12303.1.1 ID=prot_P-wetherbeei_contig12303.1.1|Name=mRNA_P-wetherbeei_contig12303.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=39bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|