prot_P-wetherbeei_contig1210.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1210.1.1 vs. uniprot
Match: A0A6H5L133_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L133_9PHAE) HSP 1 Score: 70.9 bits (172), Expect = 2.750e-11 Identity = 38/81 (46.91%), Postives = 50/81 (61.73%), Query Frame = 0 Query: 66 TLRRMQSWI----LLLAWAIVLTTLHGAEAYSARLRVQPGRAVAGEWFLEQPQLEVLGSDGATIATSFQGYATAQIQIDPS 142 +L+R WI +L W + G A++ RLRVQPGRAV GE FLEQPQ+E+L DG + F+GYATA++ PS Sbjct: 16 SLQRRHPWIQAAAILACWYVT-----GVHAHTLRLRVQPGRAVGGEAFLEQPQVEILEGDGGDVDVLFEGYATAEMISSPS 91
BLAST of mRNA_P-wetherbeei_contig1210.1.1 vs. uniprot
Match: D7FJQ0_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FJQ0_ECTSI) HSP 1 Score: 67.8 bits (164), Expect = 3.350e-10 Identity = 39/81 (48.15%), Postives = 51/81 (62.96%), Query Frame = 0 Query: 66 TLRRMQSWI----LLLAWAIVLTTLHGAEAYSARLRVQPGRAVAGEWFLEQPQLEVLGSDGATIATSFQGYATAQIQIDPS 142 + +R WI +L W I T +H A++ RLRVQPGRAV GE FLEQPQ+E+L DG + F+GYATA++ PS Sbjct: 16 SFQRRHPWIQAAAILACWYI--TKVH---AHTLRLRVQPGRAVGGEAFLEQPQVEILEGDGGDVDVLFEGYATAEMISSPS 91 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1210.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig1210.1.1 ID=prot_P-wetherbeei_contig1210.1.1|Name=mRNA_P-wetherbeei_contig1210.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=158bpback to top |