prot_P-wetherbeei_contig1208.5.3 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1208.5.3 vs. uniprot
Match: A0A7W0SFM7_9ACTN (PQQ-dependent sugar dehydrogenase n=1 Tax=Acidimicrobiia bacterium TaxID=2080302 RepID=A0A7W0SFM7_9ACTN) HSP 1 Score: 63.5 bits (153), Expect = 4.500e-9 Identity = 34/82 (41.46%), Postives = 45/82 (54.88%), Query Frame = 0 Query: 45 RFSPCSDHMFLIDKSGNFIAESTVTDEL-TFKFTIKNMVYEVADHGPTGMLIHPNFPTTPFIYIYYTADPANYWDDSCTLPP 125 RFSP +F+ +K G ++TD T + VY D G GM +HPNFPTTP+IY+ YT D Y +D+C PP Sbjct: 69 RFSP-DGRVFVAEKGGTVKVFDSLTDPTPTTAVDLSTEVYAYWDRGLLGMALHPNFPTTPYIYLLYTLDTHPY-NDACPTPP 148
BLAST of mRNA_P-wetherbeei_contig1208.5.3 vs. uniprot
Match: UPI00069B450A (PA14 domain-containing protein n=1 Tax=Calothrix sp. 336/3 TaxID=1337936 RepID=UPI00069B450A) HSP 1 Score: 52.8 bits (125), Expect = 2.710e-5 Identity = 27/86 (31.40%), Postives = 44/86 (51.16%), Query Frame = 0 Query: 46 FSPCSDHMFLIDKSGNFIAESTVTDELTFKFTIKNMVYEVADHGPTGMLIHPNFPTTPFIYIYYTADPANYWDD--SCTLPPDPEG 129 ++P MF+ K+G + T +T I V +V D G G+ +HPNF T P++Y+ +T DP +++ T DP+G Sbjct: 1407 WTPDGSRMFIAQKNGVVKVYNYATQAVTDFIDISAQVNDVRDRGLLGLAVHPNFSTNPYVYLGFTYDPPEAYNNINPNTNYDDPDG 1492
BLAST of mRNA_P-wetherbeei_contig1208.5.3 vs. uniprot
Match: A0A7W1N6C4_9ACTN (PQQ-dependent sugar dehydrogenase (Fragment) n=1 Tax=Actinomycetia bacterium TaxID=1883427 RepID=A0A7W1N6C4_9ACTN) HSP 1 Score: 52.4 bits (124), Expect = 3.300e-5 Identity = 31/93 (33.33%), Postives = 45/93 (48.39%), Query Frame = 0 Query: 45 RFSPCSDHMFLIDKSGNFIAESTVTDELTFKFT-IKNMVYEVADHGPTGMLIHPNFPTTPFIYIYYTADP-----ANYW------DDSCTLPP 125 RF+P +F+ +KSG + ++TD F ++ V+ D G GM++ P FPT P+IY+ YT D A W D C PP Sbjct: 68 RFAP-DGRIFVAEKSGMILEYDSLTDPTPTVFADLRTEVHNFWDRGLLGMVLDPQFPTRPYIYVLYTYDAPIGGTAPTWGVAGQDSDGCATPP 159
BLAST of mRNA_P-wetherbeei_contig1208.5.3 vs. uniprot
Match: A0A517MN54_9BACT (Soluble aldose sugar dehydrogenase YliI n=1 Tax=Roseimaritima multifibrata TaxID=1930274 RepID=A0A517MN54_9BACT) HSP 1 Score: 51.6 bits (122), Expect = 6.760e-5 Identity = 26/93 (27.96%), Postives = 45/93 (48.39%), Query Frame = 0 Query: 28 TLGTSTLIPSGTRRMEARFSPCSDHMFLIDKSGNFIAESTVTDELTFKFTIKNMVYEVADHGPTGMLIHPNFPTTPFIYIYYTADPANYWDDS 120 TL TL + + ++P +M++ +KSG + T I+N V + D G + +HP+F P++Y+ YT DP +D+S Sbjct: 982 TLVGETLFAELNQPTDIDWNPDGTNMYISEKSGLIKVSRNGELQATPFVDIRNQVNDTRDRGLLDIAVHPDFENNPYVYLLYTYDPPEVYDNS 1074 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1208.5.3 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig1208.5.3 ID=prot_P-wetherbeei_contig1208.5.3|Name=mRNA_P-wetherbeei_contig1208.5.3|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=135bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|