prot_P-wetherbeei_contig11876.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11876.2.1 vs. uniprot
Match: A0A3C0TYL3_9PROT (Acyl carrier protein n=1 Tax=Alphaproteobacteria bacterium TaxID=1913988 RepID=A0A3C0TYL3_9PROT) HSP 1 Score: 83.2 bits (204), Expect = 1.240e-19 Identity = 41/59 (69.49%), Postives = 48/59 (81.36%), Query Frame = 0 Query: 1 LAQVLDTIGAQIIKVLAGMVPSGAPITGETRIARDLGLDSVAIMDFVMELEERFDILIP 59 +A D I AQII LA + P+ AP++G T+IARDLGLDSVAIMDF+MELEERFDILIP Sbjct: 1 MAHKADEIAAQIIGALAAIAPASAPLSGNTKIARDLGLDSVAIMDFIMELEERFDILIP 59
BLAST of mRNA_P-wetherbeei_contig11876.2.1 vs. uniprot
Match: A0A2N3BZR1_9PROT (Acyl carrier protein n=1 Tax=Alphaproteobacteria bacterium HGW-Alphaproteobacteria-3 TaxID=2013666 RepID=A0A2N3BZR1_9PROT) HSP 1 Score: 66.6 bits (161), Expect = 4.380e-13 Identity = 31/55 (56.36%), Postives = 42/55 (76.36%), Query Frame = 0 Query: 5 LDTIGAQIIKVLAGMVPSGAPITGETRIARDLGLDSVAIMDFVMELEERFDILIP 59 ++ I +I+ +LA +P G ++ E RIARDLGLDSV IMDFVM++E+RFDI IP Sbjct: 5 VEDIEREILDLLAKQLPEGTQVSAEMRIARDLGLDSVGIMDFVMDIEDRFDISIP 59
BLAST of mRNA_P-wetherbeei_contig11876.2.1 vs. uniprot
Match: A0A858R4Z1_9PROT (Acyl carrier protein n=1 Tax=Rhodospirillaceae bacterium B3 TaxID=2728875 RepID=A0A858R4Z1_9PROT) HSP 1 Score: 62.4 bits (150), Expect = 2.010e-11 Identity = 32/54 (59.26%), Postives = 39/54 (72.22%), Query Frame = 0 Query: 6 DTIGAQIIKVLAGMVPSGAPITGETRIARDLGLDSVAIMDFVMELEERFDILIP 59 D I A+II+ L + S IT +T I RDLGLDS+A+MDFVM LE+RFDI IP Sbjct: 6 DEIVAEIIRALGPSLQSPVTITTDTNITRDLGLDSLAVMDFVMVLEDRFDISIP 59
BLAST of mRNA_P-wetherbeei_contig11876.2.1 vs. uniprot
Match: UPI001A95CEFD (acyl carrier protein n=1 Tax=Azospirillum sp. SYSU D00513 TaxID=2812561 RepID=UPI001A95CEFD) HSP 1 Score: 60.1 bits (144), Expect = 1.730e-10 Identity = 29/54 (53.70%), Postives = 40/54 (74.07%), Query Frame = 0 Query: 5 LDTIGAQIIKVLAGMVPSGAPITGETRIARDLGLDSVAIMDFVMELEERFDILI 58 LDTI A+IIK + + +T +T IARDLGLDS+A+M+FVM LE++FD+ I Sbjct: 4 LDTIAAEIIKAINALPQVQQSVTQDTNIARDLGLDSLAVMNFVMTLEDQFDVSI 57
BLAST of mRNA_P-wetherbeei_contig11876.2.1 vs. uniprot
Match: A0A239ANF3_9PROT (Acyl carrier protein n=3 Tax=Azospirillaceae TaxID=2829815 RepID=A0A239ANF3_9PROT) HSP 1 Score: 59.7 bits (143), Expect = 2.330e-10 Identity = 29/55 (52.73%), Postives = 39/55 (70.91%), Query Frame = 0 Query: 5 LDTIGAQIIKVLAGMVPSGAPITGETRIARDLGLDSVAIMDFVMELEERFDILIP 59 L+ I +II L +P+ IT +T I RDLGLDS+A+MDFVM LE++FD+ IP Sbjct: 5 LNEIVEEIITALGSTLPTPVTITTDTSITRDLGLDSLAVMDFVMVLEDKFDVSIP 59
BLAST of mRNA_P-wetherbeei_contig11876.2.1 vs. uniprot
Match: A0A8J7M9U1_9RHOB (Carrier domain-containing protein n=1 Tax=Thermohalobaculum xanthum TaxID=2753746 RepID=A0A8J7M9U1_9RHOB) HSP 1 Score: 58.9 bits (141), Expect = 4.580e-10 Identity = 29/54 (53.70%), Postives = 38/54 (70.37%), Query Frame = 0 Query: 6 DTIGAQIIKVLAGMVPSGAPITGETRIARDLGLDSVAIMDFVMELEERFDILIP 59 D I A+I+ +L+ V S +T ET I D GLDSV++MDFV+ELE+ FDI IP Sbjct: 5 DEIEARILDLLSAKVKSETAVTRETNIVADTGLDSVSVMDFVLELEDEFDINIP 58
BLAST of mRNA_P-wetherbeei_contig11876.2.1 vs. uniprot
Match: A0A0N0K9V0_9PROT (Acyl carrier protein n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0N0K9V0_9PROT) HSP 1 Score: 58.5 bits (140), Expect = 6.660e-10 Identity = 29/56 (51.79%), Postives = 41/56 (73.21%), Query Frame = 0 Query: 4 VLDTIGAQIIKVLAGMVPSGAPITGETRIARDLGLDSVAIMDFVMELEERFDILIP 59 +++TI A ++K L P+ +T ET I RDLGLDS+A+MDFVM LE++FD+ IP Sbjct: 8 IVETIIAALVKTL----PTPVTVTTETSITRDLGLDSLAVMDFVMVLEDKFDVSIP 59
BLAST of mRNA_P-wetherbeei_contig11876.2.1 vs. uniprot
Match: B6IRU2_RHOCS (Conserved domain protein n=1 Tax=Rhodospirillum centenum (strain ATCC 51521 / SW) TaxID=414684 RepID=B6IRU2_RHOCS) HSP 1 Score: 58.2 bits (139), Expect = 9.450e-10 Identity = 28/54 (51.85%), Postives = 38/54 (70.37%), Query Frame = 0 Query: 6 DTIGAQIIKVLAGMVPSGAPITGETRIARDLGLDSVAIMDFVMELEERFDILIP 59 D I +I++ L + G IT ET I RDLGLDS+A+M+FVM LE++FD+ IP Sbjct: 6 DAIIEEIVRALGPNLTPGVVITPETNITRDLGLDSLAVMNFVMVLEDKFDVSIP 59
BLAST of mRNA_P-wetherbeei_contig11876.2.1 vs. uniprot
Match: A0A839V3J0_9PROT (Acyl carrier protein n=2 Tax=Endobacter medicaginis TaxID=1181271 RepID=A0A839V3J0_9PROT) HSP 1 Score: 57.8 bits (138), Expect = 1.550e-9 Identity = 29/51 (56.86%), Postives = 39/51 (76.47%), Query Frame = 0 Query: 10 AQIIKVLA-GMVPSGAPITGETRIARDLGLDSVAIMDFVMELEERFDILIP 59 A++++ L VP+G IT ETR+A DL LDS+A+MDFVM LE RFD++IP Sbjct: 12 AEVVRSLGKAEVPAGLVITDETRLADDLKLDSLAVMDFVMALENRFDLVIP 62
BLAST of mRNA_P-wetherbeei_contig11876.2.1 vs. uniprot
Match: UPI000DF46CCE (phosphopantetheine-binding protein n=1 Tax=Oleisolibacter albus TaxID=2171757 RepID=UPI000DF46CCE) HSP 1 Score: 57.4 bits (137), Expect = 1.900e-9 Identity = 28/55 (50.91%), Postives = 38/55 (69.09%), Query Frame = 0 Query: 5 LDTIGAQIIKVLAGMVPSGAPITGETRIARDLGLDSVAIMDFVMELEERFDILIP 59 +D I +II L + + IT +T I RDLGLDS+A+MDFVM LE++FD+ IP Sbjct: 5 IDEIVTEIIHALGPSLQAPVTITPDTSITRDLGLDSLAVMDFVMVLEDKFDVSIP 59 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11876.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig11876.2.1 ID=prot_P-wetherbeei_contig11876.2.1|Name=mRNA_P-wetherbeei_contig11876.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=59bpback to top |