prot_P-wetherbeei_contig1165.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1165.2.1 vs. uniprot
Match: V4SIZ9_CITCL (Oxidoreductase-like domain-containing protein n=4 Tax=Citrus TaxID=2706 RepID=V4SIZ9_CITCL) HSP 1 Score: 53.1 bits (126), Expect = 4.460e-6 Identity = 23/61 (37.70%), Postives = 38/61 (62.30%), Query Frame = 0 Query: 68 REPASEEGLSAVKGHQERSTHPTTLAKPQEPDASACCGNGCSKCVWIMYWAELNAWEAIQK 128 REP EE + +K +++ST P++P+ CCG+GC +CVW +Y+ EL A++ + K Sbjct: 77 REPVKEENIK-IKEEEQKSTK-MLPPPPEKPEPGDCCGSGCVRCVWDVYYEELEAYDKLYK 135
BLAST of mRNA_P-wetherbeei_contig1165.2.1 vs. uniprot
Match: A0A7C9E3Q4_OPUST (Oxidoreductase-like domain-containing protein n=1 Tax=Opuntia streptacantha TaxID=393608 RepID=A0A7C9E3Q4_OPUST) HSP 1 Score: 51.6 bits (122), Expect = 1.960e-5 Identity = 24/72 (33.33%), Postives = 38/72 (52.78%), Query Frame = 0 Query: 71 ASEEGLSAVKGHQERSTHPTTLAK-------------PQEPDASACCGNGCSKCVWIMYWAELNAWEAIQKQ 129 A ++ VKG ++R T P A P++P+ CCG+GC +CVW +Y+ EL+A+ + KQ Sbjct: 73 ARSSPMAEVKGAEKRETPPPVAADEREKKPVKELXXXPEKPEPGDCCGSGCVRCVWDVYYEELDAYNQLLKQ 144
BLAST of mRNA_P-wetherbeei_contig1165.2.1 vs. uniprot
Match: UPI000B908FC6 (uncharacterized protein LOC110889476 n=1 Tax=Helianthus annuus TaxID=4232 RepID=UPI000B908FC6) HSP 1 Score: 50.4 bits (119), Expect = 2.580e-5 Identity = 23/57 (40.35%), Postives = 32/57 (56.14%), Query Frame = 0 Query: 72 SEEGLSAVKGHQERSTHPTTLAKPQEPDASACCGNGCSKCVWIMYWAELNAWEAIQK 128 S++G SAVK E P P++P CCG+GC +CVW +Y+ EL + I K Sbjct: 46 SDDGSSAVKDATEPKKPPEIPPPPEKPLPGDCCGSGCVRCVWDVYYDELEEYNKICK 102
BLAST of mRNA_P-wetherbeei_contig1165.2.1 vs. uniprot
Match: A0A103XKF0_CYNCS (Oxidoreductase-like, N-terminal n=2 Tax=Cynara cardunculus var. scolymus TaxID=59895 RepID=A0A103XKF0_CYNCS) HSP 1 Score: 51.6 bits (122), Expect = 3.140e-5 Identity = 23/57 (40.35%), Postives = 33/57 (57.89%), Query Frame = 0 Query: 72 SEEGLSAVKGHQERSTHPTTLAKPQEPDASACCGNGCSKCVWIMYWAELNAWEAIQK 128 S +GLSAVK +E P P++P CCG+GC +CVW +Y+ EL + + K Sbjct: 95 SGDGLSAVKDTKETEKLPEIPPPPEKPLPGDCCGSGCVRCVWDIYYEELEEYNKLCK 151
BLAST of mRNA_P-wetherbeei_contig1165.2.1 vs. uniprot
Match: A0A803L700_CHEQI (Oxidoreductase-like domain-containing protein n=1 Tax=Chenopodium quinoa TaxID=63459 RepID=A0A803L700_CHEQI) HSP 1 Score: 50.8 bits (120), Expect = 3.400e-5 Identity = 25/67 (37.31%), Postives = 37/67 (55.22%), Query Frame = 0 Query: 63 KPAIPREPASEEGLSAVKGHQERSTHPTTLAKPQEPDASACCGNGCSKCVWIMYWAELNAWEAIQKQ 129 KP P E E SA +E T P++P+A CCG+GC +CVW +Y+ EL A++ + K+ Sbjct: 82 KPMTPEENKEIEKESAPAKKKELPT------PPEKPEAGDCCGSGCVRCVWDVYYEELEAYDQLLKE 142
BLAST of mRNA_P-wetherbeei_contig1165.2.1 vs. uniprot
Match: A0A6S7N1F8_LACSI (Oxidoreductase-like domain-containing protein n=3 Tax=Lactuca TaxID=4235 RepID=A0A6S7N1F8_LACSI) HSP 1 Score: 50.8 bits (120), Expect = 4.450e-5 Identity = 22/61 (36.07%), Postives = 34/61 (55.74%), Query Frame = 0 Query: 68 REPASEEGLSAVKGHQERSTHPTTLAKPQEPDASACCGNGCSKCVWIMYWAELNAWEAIQK 128 +E S +GL+ VK +E P P++P CCG+GC +CVW +Y+ EL + + K Sbjct: 94 KEVQSGDGLNVVKDTKETKKSPEIPPPPEKPLPGDCCGSGCVRCVWDIYYDELEEYNKLLK 154 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1165.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 6
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig1165.2.1 ID=prot_P-wetherbeei_contig1165.2.1|Name=mRNA_P-wetherbeei_contig1165.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=140bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|