prot_P-wetherbeei_contig1164.3.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1164.3.1 vs. uniprot
Match: UPI002022A89E (FAD-binding oxidoreductase n=1 Tax=Natronobacterium sp. WLHS5 TaxID=2932267 RepID=UPI002022A89E) HSP 1 Score: 49.7 bits (117), Expect = 1.820e-5 Identity = 26/53 (49.06%), Postives = 36/53 (67.92%), Query Frame = 0 Query: 5 DDASVKALEETLRGKLILPFPESDEYDDARELWNLDITELRPAAIIQAQGASD 57 D+ ++ +E LRG LI FP+S+EY+DAR +WN I E PA I++ GASD Sbjct: 15 DENDLREFDEDLRGDLI--FPDSEEYEDARNVWNGLINEY-PAVIVRVNGASD 64
BLAST of mRNA_P-wetherbeei_contig1164.3.1 vs. uniprot
Match: A0A0M9AIM1_9EURY (Oxidoreductase n=1 Tax=Haloarcula rubripromontorii TaxID=1705562 RepID=A0A0M9AIM1_9EURY) HSP 1 Score: 48.5 bits (114), Expect = 4.830e-5 Identity = 25/53 (47.17%), Postives = 39/53 (73.58%), Query Frame = 0 Query: 5 DDASVKALEETLRGKLILPFPESDEYDDARELWNLDITELRPAAIIQAQGASD 57 D+ ++K+L++ LRG LILP +S+EY+DAR +WN I + PA I + +GA+D Sbjct: 15 DEGAIKSLDDDLRGDLILP--DSEEYEDARNVWNGLINKY-PAIITRVKGATD 64 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1164.3.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig1164.3.1 ID=prot_P-wetherbeei_contig1164.3.1|Name=mRNA_P-wetherbeei_contig1164.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=57bpback to top |