prot_P-wetherbeei_contig1161.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1161.1.1 vs. uniprot
Match: D7G3D9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G3D9_ECTSI) HSP 1 Score: 76.3 bits (186), Expect = 1.570e-14 Identity = 34/68 (50.00%), Postives = 44/68 (64.71%), Query Frame = 0 Query: 11 KTRLGKVHRRCFAGKEAVDWLLTTSICADAAEALHLLNRMLRRGHIHHVTLDNMVENKSNLHYRFAED 78 KT LG + CF+GK AVDW L +C+D +A+HLLNRML RG +HH L +VE +YRF +D Sbjct: 11 KTMLGGTIKACFSGKSAVDWCLQKDLCSDEIDAIHLLNRMLERGLLHHCRLSKLVEPSDTAYYRFPQD 78
BLAST of mRNA_P-wetherbeei_contig1161.1.1 vs. uniprot
Match: A0A6L5DG61_9INSE (Uncharacterized protein n=1 Tax=Ephemera danica TaxID=1049336 RepID=A0A6L5DG61_9INSE) HSP 1 Score: 53.5 bits (127), Expect = 2.060e-6 Identity = 33/74 (44.59%), Postives = 47/74 (63.51%), Query Frame = 0 Query: 7 LRDRKTRLGKVHRRCFAGKEAVDWLLTTS-ICADAAEALHLLNRMLRRGHIHHVTLDNMVENKSNLHYRFAEDE 79 LRDRK+ G+V RRC AG E VDWLL+ S + + ++A+ + ML G I HV+ + ++K L YRF +DE Sbjct: 207 LRDRKSSSGRVLRRCGAGSELVDWLLSQSPVVHNRSQAVAMWQAMLEEGVIAHVSQEQPFKDKLLL-YRFWQDE 279 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1161.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig1161.1.1 ID=prot_P-wetherbeei_contig1161.1.1|Name=mRNA_P-wetherbeei_contig1161.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=79bpback to top |