prot_P-wetherbeei_contig11532.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11532.1.1 vs. uniprot
Match: D7G1X1_ECTSI (DEAD box helicase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G1X1_ECTSI) HSP 1 Score: 51.2 bits (121), Expect = 1.500e-5 Identity = 35/77 (45.45%), Postives = 46/77 (59.74%), Query Frame = 0 Query: 4 LPEGLMLTHVRALHEDKDALCSLCCERQYIGRTLVFADSMAGARRRTVLLALLWLAVAALLHAQMQQWQRRCNLDLF 80 LP L L +++L +KD L C Y GRTL+F +++A ARR + LL L + A LHAQMQQ QR +LD F Sbjct: 507 LPSTLKLCSIKSLQMEKDVHAYLFCA-MYPGRTLIFVNAIAIARRLSALLCALSVP-ATPLHAQMQQRQRLKSLDRF 581
BLAST of mRNA_P-wetherbeei_contig11532.1.1 vs. uniprot
Match: A0A6H5KFI4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KFI4_9PHAE) HSP 1 Score: 50.8 bits (120), Expect = 2.070e-5 Identity = 35/77 (45.45%), Postives = 46/77 (59.74%), Query Frame = 0 Query: 4 LPEGLMLTHVRALHEDKDALCSLCCERQYIGRTLVFADSMAGARRRTVLLALLWLAVAALLHAQMQQWQRRCNLDLF 80 LP L L +++L +KD L C Y GRTL+F +++A ARR + LL L + A LHAQMQQ QR +LD F Sbjct: 672 LPSTLKLCSIKSLQMEKDVHAYLFCA-MYPGRTLIFVNAIAIARRLSALLCALNVP-ATPLHAQMQQRQRLKSLDRF 746 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11532.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig11532.1.1 ID=prot_P-wetherbeei_contig11532.1.1|Name=mRNA_P-wetherbeei_contig11532.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=82bpback to top |