prot_P-wetherbeei_contig11508.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11508.1.1 vs. uniprot
Match: A0A7S2YMT1_9STRA (Hypothetical protein n=1 Tax=Amphiprora paludosa TaxID=265537 RepID=A0A7S2YMT1_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 5.000e-7 Identity = 25/52 (48.08%), Postives = 38/52 (73.08%), Query Frame = 0 Query: 43 IDEENFLQPEWRSLDRRLRNRRTREVGE--GPRGRSNLKKSEEDFWLEAGLY 92 ID+E+ LQP W+ ++ R++NRR R E G GR+N+KK++E+ WL+ GLY Sbjct: 63 IDDEDELQPMWKGMESRVKNRRPRTRAETGGKTGRTNIKKTDEEMWLKEGLY 114
BLAST of mRNA_P-wetherbeei_contig11508.1.1 vs. uniprot
Match: A0A7S2IA71_9STRA (Hypothetical protein n=1 Tax=Helicotheca tamesis TaxID=374047 RepID=A0A7S2IA71_9STRA) HSP 1 Score: 51.6 bits (122), Expect = 9.590e-6 Identity = 25/52 (48.08%), Postives = 35/52 (67.31%), Query Frame = 0 Query: 43 IDEENFLQPEWRSLDRRLRNRRTREVGE--GPRGRSNLKKSEEDFWLEAGLY 92 I ++ LQP WR ++ R+ RRT + E G GR N++K+EED WLEAG+Y Sbjct: 97 ISSDDELQPMWRDMESRVLKRRTYTIAESGGKVGRRNIRKTEEDVWLEAGMY 148
BLAST of mRNA_P-wetherbeei_contig11508.1.1 vs. uniprot
Match: K0RA15_THAOC (Uncharacterized protein (Fragment) n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0RA15_THAOC) HSP 1 Score: 49.3 bits (116), Expect = 9.420e-5 Identity = 26/71 (36.62%), Postives = 39/71 (54.93%), Query Frame = 0 Query: 43 IDEENFLQPEWRSLDRRLRNRR--TREVGEGPRGRSNLKKSEEDFWLEAGLYVPHPARPGLPDNEWSEKAG 111 ID +QP WR ++ R+ RR T E +G GR N++KS+ED WL+AG+Y D+ ++ G Sbjct: 102 IDNYEDVQPAWREMESRVTKRRSLTLEERQGVSGRRNVRKSDEDLWLQAGVYNSSKEEASNSDSNDDQEEG 172 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11508.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig11508.1.1 ID=prot_P-wetherbeei_contig11508.1.1|Name=mRNA_P-wetherbeei_contig11508.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=113bpback to top |