prot_P-wetherbeei_contig11448.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11448.2.1 vs. uniprot
Match: A0A7S2UKR4_9STRA (Hypothetical protein n=1 Tax=Attheya septentrionalis TaxID=420275 RepID=A0A7S2UKR4_9STRA) HSP 1 Score: 59.7 bits (143), Expect = 6.190e-10 Identity = 27/51 (52.94%), Postives = 39/51 (76.47%), Query Frame = 0 Query: 5 ARAIFERGLAVDPHHAPLFHELAQLEALVGNVEGLARLDRLARRLYPEDVL 55 AR + E+GL VDP HAPL+H LA+LEA V N+EGLA+L++ A +++ + L Sbjct: 16 ARELLEKGLEVDPLHAPLYHSLAELEARVFNIEGLAKLNKRAAKVFNTNAL 66
BLAST of mRNA_P-wetherbeei_contig11448.2.1 vs. uniprot
Match: A0A7S2LJ06_9STRA (Hypothetical protein n=1 Tax=Skeletonema marinoi TaxID=267567 RepID=A0A7S2LJ06_9STRA) HSP 1 Score: 57.4 bits (137), Expect = 4.540e-9 Identity = 24/49 (48.98%), Postives = 37/49 (75.51%), Query Frame = 0 Query: 5 ARAIFERGLAVDPHHAPLFHELAQLEALVGNVEGLARLDRLARRLYPED 53 AR + E+G+ ++P HAPL+H LA+LEA V N+EGLA+L++ A ++ D Sbjct: 1 ARELLEKGMEINPLHAPLYHSLAELEARVFNIEGLAKLNKRAAEIFQSD 49
BLAST of mRNA_P-wetherbeei_contig11448.2.1 vs. uniprot
Match: A0A7S1GMC4_CYCTE (Hypothetical protein n=1 Tax=Cyclophora tenuis TaxID=216820 RepID=A0A7S1GMC4_CYCTE) HSP 1 Score: 54.7 bits (130), Expect = 2.950e-7 Identity = 25/51 (49.02%), Postives = 37/51 (72.55%), Query Frame = 0 Query: 5 ARAIFERGLAVDPHHAPLFHELAQLEALVGNVEGLARLDRLARRLYPEDVL 55 AR + E GL ++P +APL+H LA+LEA + NVEGLA+L+R A ++ + L Sbjct: 366 ARDVMEEGLRMNPRYAPLYHSLAELEARIFNVEGLAKLNRRAAAVFNANAL 416
BLAST of mRNA_P-wetherbeei_contig11448.2.1 vs. uniprot
Match: F0Y659_AURAN (Uncharacterized protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0Y659_AURAN) HSP 1 Score: 50.4 bits (119), Expect = 9.390e-6 Identity = 24/55 (43.64%), Postives = 35/55 (63.64%), Query Frame = 0 Query: 1 DLAAARAIFERGLAVDPHHAPLFHELAQLEALVGNVEGLARLDRLARRLYPEDVL 55 D RA RGL P++A L+H A+LEA++GN++GLA+L AR +P +L Sbjct: 1311 DFGGCRAALARGLDDAPNYAHLWHAAAELEAILGNLDGLAKLHERARDAFPSGLL 1365
BLAST of mRNA_P-wetherbeei_contig11448.2.1 vs. uniprot
Match: A0A7S4ERE6_9STRA (Hypothetical protein n=1 Tax=Pseudo-nitzschia australis TaxID=44445 RepID=A0A7S4ERE6_9STRA) HSP 1 Score: 48.5 bits (114), Expect = 4.490e-5 Identity = 19/51 (37.25%), Postives = 36/51 (70.59%), Query Frame = 0 Query: 5 ARAIFERGLAVDPHHAPLFHELAQLEALVGNVEGLARLDRLARRLYPEDVL 55 AR ++E G+ +P +APL+H LA+LEA++ N++ LA+L++ L+ + + Sbjct: 951 ARDVYEEGIESNPLYAPLYHSLAELEAMICNLDALAKLNKRTNELFNNNAM 1001 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11448.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 5
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig11448.2.1 ID=prot_P-wetherbeei_contig11448.2.1|Name=mRNA_P-wetherbeei_contig11448.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=55bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|