prot_P-wetherbeei_contig10542.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10542.1.1 vs. uniprot
Match: A0A836C7A2_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836C7A2_9STRA) HSP 1 Score: 77.8 bits (190), Expect = 1.100e-14 Identity = 40/61 (65.57%), Postives = 48/61 (78.69%), Query Frame = 0 Query: 37 AARLKKLGQAKMTLEEKKQRRRALHDLGLPGFRHFLQQSNLAITRLPPKILQLNIGLYCNQ 97 AARL+ LG A+MTLEEKK RRRAL +LGLP F+ +L ++ LA+ R ILQLNIGLYCNQ Sbjct: 76 AARLRALGAARMTLEEKKLRRRALDELGLPSFQQYLARAGLAVPRATSTILQLNIGLYCNQ 136
BLAST of mRNA_P-wetherbeei_contig10542.1.1 vs. uniprot
Match: A0A7S2WVW2_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2WVW2_9STRA) HSP 1 Score: 77.0 bits (188), Expect = 2.020e-14 Identity = 37/54 (68.52%), Postives = 44/54 (81.48%), Query Frame = 0 Query: 44 GQAKMTLEEKKQRRRALHDLGLPGFRHFLQQSNLAITRLPPKILQLNIGLYCNQ 97 G+ K++LEE+K RRR L DLG+PGFR F+ Q NLAI R P +ILQLNIGLYCNQ Sbjct: 80 GRQKLSLEERKARRRLLSDLGVPGFRDFITQQNLAIQRKPAEILQLNIGLYCNQ 133
BLAST of mRNA_P-wetherbeei_contig10542.1.1 vs. uniprot
Match: A0A7S4NJP5_9EUKA (Hypothetical protein n=1 Tax=Paramoeba aestuarina TaxID=180227 RepID=A0A7S4NJP5_9EUKA) HSP 1 Score: 70.1 bits (170), Expect = 5.930e-12 Identity = 35/61 (57.38%), Postives = 45/61 (73.77%), Query Frame = 0 Query: 37 AARLKKLGQAKMTLEEKKQRRRALHDLGLPGFRHFLQQSNLAITRLPPKILQLNIGLYCNQ 97 A +L+K+G M+LEE+K+RRRAL L +P F FL++ L +TR P ILQLNIGLYCNQ Sbjct: 92 AEQLRKIGAKAMSLEERKKRRRALDALQIPQFHEFLEKKKLEVTRKSPSILQLNIGLYCNQ 152
BLAST of mRNA_P-wetherbeei_contig10542.1.1 vs. uniprot
Match: A0A0G4G9C3_VITBC (Radical SAM core domain-containing protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4G9C3_VITBC) HSP 1 Score: 70.1 bits (170), Expect = 5.940e-12 Identity = 36/59 (61.02%), Postives = 45/59 (76.27%), Query Frame = 0 Query: 40 LKKLGQAKMTLEEKKQRRRALHDLGLPGFRHFLQQSNLAITRLPP-KILQLNIGLYCNQ 97 LKK GQ +++LEEKK+RRRALH LGLPGF FL+Q N+ + + LQ+NIGLYCNQ Sbjct: 90 LKKFGQKRLSLEEKKKRRRALHHLGLPGFDDFLRQRNIPLLKRDTVTTLQVNIGLYCNQ 148
BLAST of mRNA_P-wetherbeei_contig10542.1.1 vs. uniprot
Match: L1IC20_GUITC (Uncharacterized protein n=2 Tax=Geminigeraceae TaxID=589343 RepID=L1IC20_GUITC) HSP 1 Score: 69.3 bits (168), Expect = 1.110e-11 Identity = 34/61 (55.74%), Postives = 46/61 (75.41%), Query Frame = 0 Query: 37 AARLKKLGQAKMTLEEKKQRRRALHDLGLPGFRHFLQQSNLAITRLPPKILQLNIGLYCNQ 97 A LK+LGQ ++T+EE+K RRRAL +LG+P F FL N+++ + +ILQLNIGLYCNQ Sbjct: 104 ARNLKELGQQRLTMEERKNRRRALDNLGVPSFDKFLADRNVSLKKSEVEILQLNIGLYCNQ 164
BLAST of mRNA_P-wetherbeei_contig10542.1.1 vs. uniprot
Match: A0A7S0H1F3_9EUKA (Hypothetical protein (Fragment) n=1 Tax=Amorphochlora amoebiformis TaxID=1561963 RepID=A0A7S0H1F3_9EUKA) HSP 1 Score: 68.9 bits (167), Expect = 1.320e-11 Identity = 36/63 (57.14%), Postives = 48/63 (76.19%), Query Frame = 0 Query: 37 AARLKKLGQAKMTLEEKKQRRRALHDLGLPGFRHFLQQS--NLAITRLPPKILQLNIGLYCNQ 97 A RLK++G KM+LEE+KQRRRAL LG+P F FL+++ ++ + R P +I QLNIGLYCNQ Sbjct: 103 AKRLKEMGAKKMSLEERKQRRRALDKLGVPDFAEFLEKNAPSVKLQRKPAEIFQLNIGLYCNQ 165
BLAST of mRNA_P-wetherbeei_contig10542.1.1 vs. uniprot
Match: D7FPQ5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FPQ5_ECTSI) HSP 1 Score: 68.6 bits (166), Expect = 2.090e-11 Identity = 35/61 (57.38%), Postives = 44/61 (72.13%), Query Frame = 0 Query: 37 AARLKKLGQAKMTLEEKKQRRRALHDLGLPGFRHFLQQSNLAITRLPPKILQLNIGLYCNQ 97 AA+LK++GQ K+TLEEKK RRRAL D LP F+ +Q+ + I R I QLNIGL+CNQ Sbjct: 108 AAKLKQMGQKKLTLEEKKIRRRALKDRNLPSFQQHVQEQGIKINRESSTIFQLNIGLFCNQ 168
BLAST of mRNA_P-wetherbeei_contig10542.1.1 vs. uniprot
Match: A0A7S2AR26_9STRA (Hypothetical protein n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2AR26_9STRA) HSP 1 Score: 67.8 bits (164), Expect = 3.180e-11 Identity = 31/54 (57.41%), Postives = 41/54 (75.93%), Query Frame = 0 Query: 44 GQAKMTLEEKKQRRRALHDLGLPGFRHFLQQSNLAITRLPPKILQLNIGLYCNQ 97 GQ K++LEE+K RRRAL +LG+P F+ F++Q + R P +I QLNIGLYCNQ Sbjct: 3 GQKKLSLEERKIRRRALSELGIPDFKEFIKQQGVQAVRAPAEIFQLNIGLYCNQ 56
BLAST of mRNA_P-wetherbeei_contig10542.1.1 vs. uniprot
Match: A0A1Y1HHY5_KLENI (Uncharacterized protein n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1HHY5_KLENI) HSP 1 Score: 67.8 bits (164), Expect = 3.620e-11 Identity = 34/55 (61.82%), Postives = 43/55 (78.18%), Query Frame = 0 Query: 44 GQAKMTLEEKKQRRRALHDLGLPGFRHFLQQSNLA-ITRLPPKILQLNIGLYCNQ 97 GQA +T EE+K+RRRAL +LG+P F HFL++ L+ +TR P LQLNIGLYCNQ Sbjct: 49 GQAALTAEERKKRRRALDNLGVPSFDHFLKEQGLSPLTRKPVTTLQLNIGLYCNQ 103
BLAST of mRNA_P-wetherbeei_contig10542.1.1 vs. uniprot
Match: A0A8J2SJC1_9STRA (Hypothetical protein n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A8J2SJC1_9STRA) HSP 1 Score: 66.2 bits (160), Expect = 1.340e-10 Identity = 35/62 (56.45%), Postives = 45/62 (72.58%), Query Frame = 0 Query: 37 AARLKKLGQAKMTLEEKKQRRRALHDLGLPGF-RHFLQQSNLAITRLPPKILQLNIGLYCNQ 97 A +L++ GQ K+TLEEK++RRR L +LG P F H LQQ+ TR ++LQLNIGLYCNQ Sbjct: 98 AKKLRESGQRKLTLEEKQRRRRCLEELGAPEFTEHLLQQAGCDGTRFATEVLQLNIGLYCNQ 159 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10542.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig10542.1.1 ID=prot_P-wetherbeei_contig10542.1.1|Name=mRNA_P-wetherbeei_contig10542.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=98bpback to top |