prot_P-wetherbeei_contig10417.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10417.1.1 vs. uniprot
Match: A0A7Y8JB18_9RHOO (Entericidin A/B family lipoprotein n=1 Tax=Rhodocyclaceae bacterium TaxID=1898103 RepID=A0A7Y8JB18_9RHOO) HSP 1 Score: 58.2 bits (139), Expect = 5.740e-10 Identity = 28/39 (71.79%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 32 MNKLVYLVLLCAALAGCNTVQGIGRDVEQGGEAIQRAVK 70 M KL+ L L LAGCNTVQGIG+D+E+GGEAIQRAVK Sbjct: 1 MKKLLGLCALIVFLAGCNTVQGIGKDIEKGGEAIQRAVK 39
BLAST of mRNA_P-wetherbeei_contig10417.1.1 vs. uniprot
Match: A0A1F4AY98_9PROT (Entericidin n=3 Tax=unclassified Betaproteobacteria TaxID=33809 RepID=A0A1F4AY98_9PROT) HSP 1 Score: 56.2 bits (134), Expect = 3.890e-9 Identity = 23/44 (52.27%), Postives = 35/44 (79.55%), Query Frame = 0 Query: 28 KELAMNKLVYLVLLCAALAGCNTVQGIGRDVEQGGEAIQRAVKK 71 KE+ M KL++L L+ +GCNT+QG+G+D++QGGEA++RA K Sbjct: 3 KEIGMKKLLFLTLVVLFTSGCNTLQGVGKDLKQGGEALERAGSK 46
BLAST of mRNA_P-wetherbeei_contig10417.1.1 vs. uniprot
Match: UPI001BBC639E (Entericidin A/B family lipoprotein n=1 Tax=Sulfuritalea sp. TaxID=2480090 RepID=UPI001BBC639E) HSP 1 Score: 55.5 bits (132), Expect = 6.680e-9 Identity = 24/39 (61.54%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 32 MNKLVYLVLLCAALAGCNTVQGIGRDVEQGGEAIQRAVK 70 M +++ L+ LAGCNTVQGIG+D+E+GGEAIQ+AVK Sbjct: 1 MKRILCLIAAAVFLAGCNTVQGIGKDIEKGGEAIQKAVK 39
BLAST of mRNA_P-wetherbeei_contig10417.1.1 vs. uniprot
Match: A0A2H0G4S7_9PROT (Entericidin n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2H0G4S7_9PROT) HSP 1 Score: 55.1 bits (131), Expect = 1.160e-8 Identity = 23/37 (62.16%), Postives = 32/37 (86.49%), Query Frame = 0 Query: 34 KLVYLVLLCAALAGCNTVQGIGRDVEQGGEAIQRAVK 70 K+V L + A +AGCNTV+G+G+D+E+GGEAIQ+AVK Sbjct: 13 KIVLLAAIAAGVAGCNTVKGVGQDIEKGGEAIQKAVK 49
BLAST of mRNA_P-wetherbeei_contig10417.1.1 vs. uniprot
Match: A0A518U8X3_9PROT (Entericidin n=1 Tax=Denitratisoma sp. DHT3 TaxID=1981880 RepID=A0A518U8X3_9PROT) HSP 1 Score: 54.7 bits (130), Expect = 1.370e-8 Identity = 26/40 (65.00%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 32 MNKLVYLVLLCA-ALAGCNTVQGIGRDVEQGGEAIQRAVK 70 M +L +++L+ A L GCNTVQGIGRD+E+GGEAIQ+AVK Sbjct: 1 MKRLSFVLLVLALGLVGCNTVQGIGRDIEKGGEAIQKAVK 40
BLAST of mRNA_P-wetherbeei_contig10417.1.1 vs. uniprot
Match: A0A011MMU3_9PROT (3-isopropylmalate dehydratase large subunit n=6 Tax=unclassified Candidatus Accumulibacter TaxID=2619054 RepID=A0A011MMU3_9PROT) HSP 1 Score: 57.4 bits (137), Expect = 6.670e-8 Identity = 32/70 (45.71%), Postives = 45/70 (64.29%), Query Frame = 0 Query: 3 YPRRWRPLLPSPDISSTYANGVNNR--KELAMNKLVYLVLLCAALAGCNTVQGIGRDVEQGGEAIQRAVK 70 +PRR R L IS+ ANG + + N+ + +VL A+AGCNTVQGIG+D+E+GG+AI RA + Sbjct: 441 WPRRQRLLA----ISAMSANGPRRQGAEMKRRNRFLLIVLAAIAVAGCNTVQGIGKDIEKGGQAIGRAAR 506
BLAST of mRNA_P-wetherbeei_contig10417.1.1 vs. uniprot
Match: A0A3N0V5H9_9PROT (Entericidin A/B family lipoprotein n=1 Tax=Pseudomethylobacillus aquaticus TaxID=2676064 RepID=A0A3N0V5H9_9PROT) HSP 1 Score: 52.8 bits (125), Expect = 7.770e-8 Identity = 23/39 (58.97%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 32 MNKLVYLVLLCAALAGCNTVQGIGRDVEQGGEAIQRAVK 70 MNK+ L++ A LAGCNTV G+G+D+E+GGEAIQ++ K Sbjct: 1 MNKVFLLLVSMAFLAGCNTVAGVGKDLEKGGEAIQKSAK 39
BLAST of mRNA_P-wetherbeei_contig10417.1.1 vs. uniprot
Match: A0A7X6WS83_9BURK (Entericidin A/B family lipoprotein n=1 Tax=Oxalobacter sp. TaxID=2093374 RepID=A0A7X6WS83_9BURK) HSP 1 Score: 52.0 bits (123), Expect = 1.570e-7 Identity = 21/39 (53.85%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 32 MNKLVYLVLLCAALAGCNTVQGIGRDVEQGGEAIQRAVK 70 M KL L+ + A LAGCNTVQG+G+D+++GGEA+++A + Sbjct: 1 MKKLFVLMAVIAFLAGCNTVQGVGKDIQKGGEAVEKAAQ 39
BLAST of mRNA_P-wetherbeei_contig10417.1.1 vs. uniprot
Match: A0A1N7A4L1_9GAMM (Entericidin B n=1 Tax=Aeromonas sp. RU39B TaxID=1907416 RepID=A0A1N7A4L1_9GAMM) HSP 1 Score: 52.0 bits (123), Expect = 1.570e-7 Identity = 22/39 (56.41%), Postives = 28/39 (71.79%), Query Frame = 0 Query: 32 MNKLVYLVLLCAALAGCNTVQGIGRDVEQGGEAIQRAVK 70 M LVY +LLC L+ CNTV+GIG D++Q G AI RA + Sbjct: 1 MRSLVYALLLCGLLSACNTVRGIGEDIQQAGSAISRATR 39
BLAST of mRNA_P-wetherbeei_contig10417.1.1 vs. uniprot
Match: A0A1Q3R9G1_9BURK (Entericidin n=1 Tax=Burkholderiales bacterium 68-10 TaxID=1895730 RepID=A0A1Q3R9G1_9BURK) HSP 1 Score: 52.0 bits (123), Expect = 1.570e-7 Identity = 21/39 (53.85%), Postives = 31/39 (79.49%), Query Frame = 0 Query: 32 MNKLVYLVLLCAALAGCNTVQGIGRDVEQGGEAIQRAVK 70 M K ++LV + ALAGCNTVQG+G+DV++ G A+++A K Sbjct: 1 MKKALFLVAIAFALAGCNTVQGVGKDVQKAGSAVEKAAK 39 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10417.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig10417.1.1 ID=prot_P-wetherbeei_contig10417.1.1|Name=mRNA_P-wetherbeei_contig10417.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=72bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|