prot_P-wetherbeei_contig1038.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1038.2.1 vs. uniprot
Match: A0A6H5JDQ5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JDQ5_9PHAE) HSP 1 Score: 83.6 bits (205), Expect = 1.050e-16 Identity = 43/82 (52.44%), Postives = 60/82 (73.17%), Query Frame = 0 Query: 1 MAKSIRSKVKKKNRAEQRRLVGDPNRKRLQARSVSTLRKSLRFKSGDGIDKLKSMLATEEVHNPPVPETARHAFVFRHPNAP 82 MAKSIRSKVKK+NR E R+ VGDP++++LQAR + ++KS+ F +G+ + KLK ML + NPP E ++ F FRHP+AP Sbjct: 1 MAKSIRSKVKKRNRTEMRKNVGDPHQRKLQARCTAKIQKSVAFSAGESVTKLKGMLTAAQAANPPSKEVSKSGFSFRHPDAP 82
BLAST of mRNA_P-wetherbeei_contig1038.2.1 vs. uniprot
Match: D7G0M3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0M3_ECTSI) HSP 1 Score: 83.6 bits (205), Expect = 1.220e-16 Identity = 43/82 (52.44%), Postives = 60/82 (73.17%), Query Frame = 0 Query: 1 MAKSIRSKVKKKNRAEQRRLVGDPNRKRLQARSVSTLRKSLRFKSGDGIDKLKSMLATEEVHNPPVPETARHAFVFRHPNAP 82 MAKSIRSKVKK+NR E R+ VGDP++++LQAR + ++KS+ F +G+ + KLK ML + NPP E ++ F FRHP+AP Sbjct: 1 MAKSIRSKVKKRNRTEMRKNVGDPHQRKLQARCTAKIQKSVAFSAGESVTKLKGMLTAAQAANPPSKEVSKSGFSFRHPDAP 82
BLAST of mRNA_P-wetherbeei_contig1038.2.1 vs. uniprot
Match: A0A835Z2D3_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z2D3_9STRA) HSP 1 Score: 73.2 bits (178), Expect = 6.380e-13 Identity = 37/81 (45.68%), Postives = 60/81 (74.07%), Query Frame = 0 Query: 1 MAKSIRSKVKKKNRAEQRRLVGDPNRKRLQARSVSTLRKSLRFKSGDGIDKLKSMLATEEVHNPPVPETARHAFVFRHPNA 81 MAKSIRSKVKK+NRA+ R+ G+P+ +++QA+ + L++++++ SG GI+KLK +L + NP PE ++H+ F+HP A Sbjct: 1 MAKSIRSKVKKRNRADMRKQYGEPHAQQIQAKCTARLQETVQYHSGPGINKLKGLLNKAQAENPLQPEVSKHSHTFKHPYA 81 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1038.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig1038.2.1 ID=prot_P-wetherbeei_contig1038.2.1|Name=mRNA_P-wetherbeei_contig1038.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=186bpback to top |