prot_P-wetherbeei_contig1034.4.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1034.4.1 vs. uniprot
Match: A0A7S2CE03_9STRA (Hypothetical protein n=2 Tax=Florenciella parvula TaxID=236787 RepID=A0A7S2CE03_9STRA) HSP 1 Score: 56.6 bits (135), Expect = 5.230e-5 Identity = 30/82 (36.59%), Postives = 43/82 (52.44%), Query Frame = 0 Query: 76 FYEGSADLPFGTTLRVREQPHTDADTMGTVAAHSLIYAVERRGHWIRVCCSDADVSDDSG--GQRLDGWMLTATADRTLLVP 155 +Y +P G L+VRE+P+ DA +G + AH I G W V +D + + + + +GWMLT TA R LLVP Sbjct: 157 WYRVEDTMPKGAVLKVRERPNADAPVIGGLPAHHAIEVTVSSGDWCMVIYTDPETREHNPHKAEVKEGWMLTRTARRLLLVP 238 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1034.4.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig1034.4.1 ID=prot_P-wetherbeei_contig1034.4.1|Name=mRNA_P-wetherbeei_contig1034.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=476bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|